Result : EXP01932
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01932 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 196305 |
| Right | 196430 |
| Strand | + |
| Nucleotide Sequence | GTGAAAACATTTACTGCGCCGAGCTGGAAAACGTTCTGGCCAGCCATCCCGACATCGCCGAAGTCGCGGTCATCGGCCGGGCCGACGAGAAGTGGGGAGAGGTGCCGATCGCGGTCGCGGCCGTAA |
| Sequence | VKTFTAPSWKTFWPAIPTSPKSRSSAGPTRSGERCRSRSRP |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 202975 | 203100 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 196305 | 196430 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 966706 | 966825 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 4 | 1725099 | 1725209 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 5 | 5924757 | 5924876 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03364.22 | 0.6 | 3 | 2194 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 2 | PF10604.11 | 0.6 | 3 | 2194 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 3 | PF00392.23 | 0.6 | 3 | 1367 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 4 | PF00501.30 | 1.0 | 5 | -119 | same-strand | AMP-binding enzyme |
| 5 | PF13193.8 | 1.0 | 5 | -119 | same-strand | AMP-binding enzyme C-terminal domain |
| 6 | PF02405.18 | 0.6 | 3 | 844.0 | same-strand | Permease MlaE |
| 7 | PF11887.10 | 0.6 | 3 | 2739.0 | same-strand | Cholesterol uptake porter CUP1 of Mce4, putative |
| 8 | PF02470.22 | 0.6 | 3 | 3465 | same-strand | MlaD protein |
++ More..