Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01920 |
NCBI Accession ID | NC_000962.3 |
Organism | Mycobacterium tuberculosis H37Rv |
Left | 1354193 |
Right | 1354315 |
Strand | + |
Nucleotide Sequence | GTGATTTGGCAGTTCAATGTCGGGTATGGCTGGAAATCCAATGGCGGGGCATGCTCGGCGCCGACCAGGCTCGCGCAGGCGGGCCAGCCCGAATCTGGAGGGAGCACTCAATGGCGGCGATGA |
Sequence | VIWQFNVGYGWKSNGGACSAPTRLAQAGQPESGGSTQWRR |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | 26536359 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 40 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1374249 | 1374371 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
2 | 1354193 | 1354315 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
3 | 5197695 | 5197817 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
4 | 876035 | 876157 | + | NZ_AP022581.1 | Mycobacterium lacus |
5 | 3401725 | 3401847 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
6 | 1570156 | 1570278 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
7 | 2796362 | 2796484 | - | NZ_AP022582.1 | Mycobacterium seoulense |
8 | 39347 | 39469 | - | NZ_CP058277.1 | Mycobacterium marinum |
9 | 1461336 | 1461458 | + | NZ_AP022572.1 | Mycobacterium shottsii |
10 | 2680159 | 2680281 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
11 | 4074902 | 4075024 | + | NZ_AP022568.1 | Mycobacterium simiae |
12 | 1769774 | 1769896 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
13 | 4243297 | 4243419 | - | NZ_LR130759.1 | Mycobacterium basiliense |
14 | 451703 | 451825 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
15 | 5315004 | 5315126 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
16 | 5074270 | 5074392 | + | NZ_AP022576.1 | Mycobacterium florentinum |
17 | 3123387 | 3123509 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
18 | 1245542 | 1245664 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
19 | 4055354 | 4055476 | - | NZ_AP018164.1 | Mycobacterium shigaense |
20 | 2238630 | 2238752 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
21 | 180278 | 180400 | + | NZ_AP022614.1 | Mycobacterium parmense |
22 | 3019125 | 3019247 | - | NZ_AP022590.1 | Mycobacterium mantenii |
23 | 1241784 | 1241906 | + | NZ_CP023147.1 | Mycobacterium marseillense |
24 | 1200658 | 1200780 | + | NZ_CP029543.1 | Mycobacterium leprae |
25 | 1280461 | 1280583 | + | NC_016948.1 | Mycobacterium paraintracellulare |
26 | 1270051 | 1270173 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
27 | 2924606 | 2924728 | + | NZ_AP022606.1 | Mycobacterium branderi |
28 | 4385647 | 4385769 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
29 | 582432 | 582536 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
30 | 883009 | 883146 | + | NZ_CP053642.1 | Actinomyces marmotae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00809.24 | 0.97 | 29 | 2049 | same-strand | Pterin binding enzyme |
2 | PF03352.15 | 0.97 | 29 | 59 | same-strand | Methyladenine glycosylase |
3 | PF11314.10 | 0.97 | 29 | -12 | same-strand | Protein of unknown function (DUF3117) |
4 | PF00534.22 | 0.93 | 28 | 182.5 | opposite-strand | Glycosyl transferases group 1 |
5 | PF13439.8 | 0.9 | 27 | 183 | opposite-strand | Glycosyltransferase Family 4 |
6 | PF13692.8 | 0.93 | 28 | 182.5 | opposite-strand | Glycosyl transferases group 1 |
7 | PF13579.8 | 0.9 | 27 | 183 | opposite-strand | Glycosyl transferase 4-like domain |
8 | PF13524.8 | 0.93 | 28 | 182.5 | opposite-strand | Glycosyl transferases group 1 |
9 | PF00483.25 | 0.93 | 28 | 1542.5 | same-strand | Nucleotidyl transferase |
10 | PF04191.15 | 0.63 | 19 | 3474 | opposite-strand | Phospholipid methyltransferase |
11 | PF00501.30 | 0.8 | 24 | 3075.5 | same-strand | AMP-binding enzyme |
12 | PF13193.8 | 0.83 | 25 | 3073 | same-strand | AMP-binding enzyme C-terminal domain |