Result : EXP01913
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01913 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 6549677 |
| Right | 6549829 |
| Strand | - |
| Nucleotide Sequence | GTGTCGTACCAGGCAGGCGAAACCCGCCACTTCCACTTCGGGCCGGGAGAATTCCTGCTGCACGACATCGAGAACATCGGTGACACCGAACTCGTGTTCACCACCGTCGAACATCTGGACAGCGACAACGCGCCGCTGCCGGTCACCCGGTGA |
| Sequence | VSYQAGETRHFHFGPGEFLLHDIENIGDTELVFTTVEHLDSDNAPLPVTR |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 981621 | 981773 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 2 | 5348429 | 5348590 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 3 | 1808891 | 1809046 | + | NZ_CP020715.1 | Cnuibacter physcomitrellae |
| 4 | 5350407 | 5350553 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 5 | 5517619 | 5517765 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 6 | 2819440 | 2819592 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 7 | 1125402 | 1125548 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 8 | 659720 | 659866 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 9 | 278728 | 278877 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 10 | 5005757 | 5005903 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 11 | 3266033 | 3266200 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 12 | 2006738 | 2006914 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
| 13 | 4369242 | 4369412 | - | NZ_CP033219.1 | Parasedimentitalea marina |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012150.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04909.16 | 0.77 | 10 | 1519.0 | same-strand | Amidohydrolase |
++ More..