Result : EXP01912
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01912 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 6276404 |
| Right | 6276556 |
| Strand | - |
| Nucleotide Sequence | ATGCCACGAGGTGACGGGATCTACGACGAAGAGCATCGCGACCACGACACGGGCAGCGCGGCCGAAGGTGGTGCGGGCAAGCCCAAGCGCGTGCCGGAGGACACCCCGGACGTCGAGATGCCCGACGAGACCACACAGGAACCGCCGGACTGA |
| Sequence | MPRGDGIYDEEHRDHDTGSAAEGGAGKPKRVPEDTPDVEMPDETTQEPPD |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6276342 | 6276494 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 676669 | 676815 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 725352 | 725498 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 4 | 5662481 | 5662627 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10604.11 | 1.0 | 4 | 1678.5 | opposite-strand | Polyketide cyclase / dehydrase and lipid transport |
| 2 | PF13622.8 | 1.0 | 4 | 836.5 | opposite-strand | Thioesterase-like superfamily |
| 3 | PF01814.25 | 0.75 | 3 | 125 | opposite-strand | Hemerythrin HHE cation binding domain |
| 4 | PF05067.14 | 0.75 | 3 | 763 | same-strand | Manganese containing catalase |
| 5 | PF09424.12 | 1.0 | 4 | 1712.5 | same-strand | Yqey-like protein |
| 6 | PF04402.16 | 1.0 | 4 | 2192.0 | same-strand | Protein of unknown function (DUF541) |
++ More..