Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01909 |
NCBI Accession ID | CP000480.1 |
Organism | Mycolicibacterium smegmatis MC2 155 |
Left | 3811605 |
Right | 3811745 |
Strand | - |
Nucleotide Sequence | GTGGGTTGGCAGGCCACAGCTAGTCTCAGCGATTCCCTGCCCTTCGTCACGGAGGATGCTTTTGCCCGCGTTACGCAAGCACCCGCAAACCGCCACGAAACACCTCTTCGTCACCGGTGGAGTTGTTTCGTCGCTGGGTAA |
Sequence | VGWQATASLSDSLPFVTEDAFARVTQAPANRHETPLRHRWSCFVAG |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | 32181921 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4539159 | 4539299 | + | NZ_CP012150.1 | Mycobacterium goodii |
2 | 3889283 | 3889423 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01728.21 | 1.0 | 2 | 5035.0 | same-strand | FtsJ-like methyltransferase |
2 | PF20143.1 | 1.0 | 2 | 4115.0 | same-strand | ATP-NAD kinase C-terminal domain |
3 | PF01513.23 | 1.0 | 2 | 4115.0 | same-strand | ATP-NAD kinase N-terminal domain |
4 | PF02463.21 | 1.0 | 2 | 2336.0 | same-strand | RecF/RecN/SMC N terminal domain |
5 | PF12555.10 | 1.0 | 2 | 1021.0 | same-strand | Thiamine pyrophosphokinase C terminal |
6 | PF11382.10 | 1.0 | 2 | 76.0 | same-strand | Copper transport outer membrane protein, MctB |
7 | PF06418.16 | 1.0 | 2 | -79.0 | same-strand | CTP synthase N-terminus |
8 | PF00117.30 | 1.0 | 2 | -79.0 | same-strand | Glutamine amidotransferase class-I |
9 | PF00293.30 | 1.0 | 2 | 1686.0 | same-strand | NUDIX domain |
10 | PF00589.24 | 1.0 | 2 | 2303.0 | same-strand | Phage integrase family |
11 | PF02899.19 | 1.0 | 2 | 2303.0 | same-strand | Phage integrase, N-terminal SAM-like domain |
12 | PF13614.8 | 1.0 | 2 | 3393.5 | same-strand | AAA domain |
13 | PF01656.25 | 1.0 | 2 | 3393.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
14 | PF06564.14 | 1.0 | 2 | 3393.5 | same-strand | Cellulose biosynthesis protein BcsQ |
15 | PF00142.20 | 1.0 | 2 | 3393.5 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
16 | PF02616.16 | 1.0 | 2 | 4259.5 | same-strand | Segregation and condensation protein ScpA |