ProsmORF-pred
Result : EXP01908
Protein Information
Information Type Description
Protein name EXP01908
NCBI Accession ID CP000480.1
Organism Mycolicibacterium smegmatis MC2 155
Left 3816778
Right 3816915
Strand -
Nucleotide Sequence GTGACGGCCAGCCCGCTTCCCGGGCCCTCGGGCAACGTGGAGTACTTCCTGAGGCTGCGCGCCGAGACCGATTCGCCGCTGGAGGGGGACGCGCTTGAAGCTGCGGTCCGCCGGGCGGTCGAGGAAGGGCCGCAATGA
Sequence VTASPLPGPSGNVEYFLRLRAETDSPLEGDALEAAVRRAVEEGPQ
Source of smORF Transcriptional-level
Function
Pubmed ID 32181921
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 45
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 209
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3894458 3894595 - NZ_LN831039.1 Mycolicibacterium smegmatis
2 4533987 4534124 + NZ_CP012150.1 Mycobacterium goodii
3 3052054 3052191 + NZ_CP020809.1 Mycobacterium dioxanotrophicus
4 7076693 7076830 - NZ_AP022567.1 Mycolicibacterium mageritense
5 3237160 3237282 + NZ_AP022560.1 Mycolicibacterium moriokaense
6 3851852 3851974 - NZ_AP022574.1 Mycolicibacterium psychrotolerans
7 3379427 3379564 - NZ_CP062008.1 Mycolicibacterium mucogenicum DSM 44124
8 533492 533629 + NZ_AP022565.1 Mycolicibacterium alvei
9 3424932 3425054 - NZ_AP022610.1 Mycolicibacterium madagascariense
10 4142147 4142284 + NZ_AP022579.1 Mycolicibacterium boenickei
11 1424764 1424901 + NZ_AP022586.1 Mycolicibacterium litorale
12 424542 424664 + NZ_AP022616.1 Mycolicibacterium phocaicum
13 3545833 3545970 - NZ_CP011269.1 Mycolicibacterium fortuitum
14 629986 630129 + NZ_AP022608.1 Mycolicibacterium gadium
15 3707916 3708038 + NZ_AP022595.1 Mycolicibacterium sarraceniae
16 1688880 1689017 - NZ_AP022620.1 Mycolicibacterium anyangense
17 986611 986754 - NZ_AP022587.1 Mycobacterium stomatepiae
18 4025569 4025703 + NZ_AP022598.1 Mycolicibacterium parafortuitum
19 4040131 4040268 + NZ_CP043474.1 Mycobacterium grossiae
20 3497981 3498124 - NC_008726.1 Mycolicibacterium vanbaalenii PYR-1
21 1695812 1695970 + NZ_AP022581.1 Mycobacterium lacus
22 5017143 5017280 - NZ_AP022599.1 Mycolicibacterium pulveris
23 4163802 4163939 + NZ_AP022588.1 Mycolicibacterium sediminis
24 5245694 5245831 - NZ_AP022600.1 Mycolicibacterium tokaiense
25 2121171 2121314 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
26 2727870 2728007 - NZ_AP024310.1 Mycobacterium heckeshornense
27 2924441 2924578 + NZ_CP011491.1 Mycolicibacterium vaccae 95051
28 1577052 1577189 + NZ_CP029543.1 Mycobacterium leprae
29 2271377 2271514 + NZ_LT906483.1 Mycolicibacterium thermoresistibile
30 731092 731229 - NZ_AP022593.1 Mycolicibacterium arabiense
31 3370472 3370603 + NZ_AP022570.1 Mycolicibacterium poriferae
32 5761317 5761454 - NZ_AP022568.1 Mycobacterium simiae
33 1762473 1762616 - NZ_AP022614.1 Mycobacterium parmense
34 1401738 1401857 + NZ_AP022609.1 Mycolicibacter hiberniae
35 2229972 2230106 + NZ_LR134355.1 Mycolicibacterium chitae
36 2591242 2591385 + NZ_AP022613.1 Mycobacterium conspicuum
37 2120410 2120553 + NZ_AP022612.1 Mycolicibacterium confluentis
38 5150191 5150328 - NZ_AP023396.1 Nocardia wallacei
39 2121666 2121791 + NZ_CP024633.1 Mycobacteroides salmoniphilum
40 4204284 4204406 - NZ_CP022753.1 Nocardiopsis gilva YIM 90087
41 3515300 3515449 - NZ_CP022088.2 Nocardia brasiliensis
42 1731980 1732105 + NZ_CP048813.1 Rhodococcus triatomae
43 2832353 2832514 - NZ_CP027793.1 Rhodococcus hoagii
44 1295844 1295978 + NZ_CP009246.1 Corynebacterium flavescens
45 2265920 2266045 - NZ_CP010271.1 Mycobacteroides saopaulense
46 2361611 2361736 + NZ_CP007220.1 Mycobacteroides chelonae CCUG 47445
47 1091273 1091422 + NZ_CP033897.1 Corynebacterium gerontici
48 5354333 5354467 - NZ_CP026746.1 Nocardia cyriacigeorgica
49 2291853 2291978 + NZ_AP018165.1 [Mycobacterium] stephanolepidis
50 3282261 3282398 + NZ_LR134352.1 Nocardia asteroides
51 2551731 2551856 + NZ_CP011530.1 Mycobacteroides immunogenum
52 2238316 2238465 - NZ_CP033325.1 Georgenia faecalis
53 1068945 1069100 - NZ_AP022603.1 Mycolicibacterium fallax
54 1298174 1298299 - NZ_CP033898.1 Corynebacterium pseudopelargi
55 897991 898137 + NZ_CP020468.1 Actinomyces gaoshouyii
56 1983007 1983144 - NZ_CP038157.1 Corynebacterium sanguinis
57 3349884 3350024 - NZ_AP023172.1 Rhodococcus qingshengii
58 305246 305386 + NZ_LS483468.1 Rhodococcus coprophilus
59 1589059 1589181 + NC_015564.1 Hoyosella subflava DQS3-9A1
60 1274230 1274364 + NZ_LS483460.1 Corynebacterium minutissimum
61 2968822 2968959 - NZ_LT906450.1 Rhodococcus rhodochrous
62 172359 172493 + NZ_CP014635.1 Corynebacterium simulans
63 3284570 3284707 - NZ_CP022208.1 Rhodococcus pyridinivorans
64 2749025 2749162 - NZ_CP029146.1 Rhodococcus ruber
65 1619666 1619809 + NC_004369.1 Corynebacterium efficiens YS-314
66 1284853 1284978 - NZ_CP026947.1 Corynebacterium yudongzhengii
67 2293302 2293439 + NZ_CP018082.1 Nocardia mangyaensis
68 7163072 7163206 - NZ_CP045572.1 Nonomuraea nitratireducens
69 1415835 1415996 + NZ_CP009220.1 Corynebacterium deserti GIMN1.010
70 7315931 7316062 - NC_019673.1 Saccharothrix espanaensis DSM 44229
71 2172888 2173022 + NC_006361.1 Nocardia farcinica IFM 10152
72 1531484 1531603 - NZ_CP010827.1 Corynebacterium singulare
73 6759547 6759669 + NZ_CP030073.1 Streptomyces cadmiisoli
74 1459340 1459483 - NZ_CP067012.1 Corynebacterium kefirresidentii
75 1527890 1528021 - NZ_CP029043.1 Streptomyces nigra
76 1132090 1132239 + NZ_CP009215.1 Corynebacterium ureicelerivorans
77 2544642 2544764 + NC_013510.1 Thermomonospora curvata DSM 43183
78 5907694 5907846 + NZ_CP061007.1 Saccharopolyspora spinosa
79 1698818 1698940 - NZ_CP023695.1 Streptomyces alboniger
80 6687735 6687887 - NC_022116.1 Amycolatopsis mediterranei RB
81 144439 144576 + NZ_LT906443.1 Corynebacterium ulcerans
82 3665 3829 + NZ_LR134476.1 Trueperella bialowiezensis
83 1604968 1605108 + NZ_CP015453.1 Dietzia psychralcaliphila
84 6186533 6186664 + NZ_CP023702.1 Streptomyces nitrosporeus
85 454742 454882 + NZ_CP032788.1 Corynebacterium xerosis
86 761108 761248 - NZ_CP042429.1 Corynebacterium nuruki S6-4
87 3151219 3151341 - NC_013757.1 Geodermatophilus obscurus DSM 43160
88 856108 856239 - NZ_CP009922.3 Streptomyces xiamenensis
89 704921 705064 - NZ_CP068168.1 Corynebacterium amycolatum
90 5010939 5011061 - NZ_CP030862.1 Streptomyces globosus
91 1348832 1348954 - NZ_CP070242.1 Streptomyces californicus
92 1336954 1337076 - NZ_CP020570.1 Streptomyces violaceoruber
93 5972276 5972407 + NZ_CP023202.1 Streptomyces xinghaiensis S187
94 1295904 1296044 - NZ_CP035299.1 Corynebacterium pelargi
95 1038441 1038578 + NC_017301.2 Corynebacterium pseudotuberculosis C231
96 6415247 6415369 + NC_016109.1 Kitasatospora setae KM-6054
97 1079281 1079424 - NZ_CP070228.1 Arcanobacterium phocisimile
98 664763 664897 + NZ_CP066065.1 Schaalia meyeri
99 5719928 5720050 + NZ_CP023692.1 Streptomyces vinaceus
100 1907246 1907377 - NZ_CP012382.1 Streptomyces ambofaciens ATCC 23877
101 1440367 1440504 + NZ_CP015622.1 Corynebacterium crudilactis
102 1187478 1187600 - NZ_CP017316.1 Streptomyces rubrolavendulae
103 1212939 1213061 - NZ_CP023696.1 Streptomyces fradiae ATCC 10745 = DSM 40063
104 4995347 4995475 + NZ_CP016793.1 Lentzea guizhouensis
105 1401313 1401438 + NC_020506.1 Corynebacterium callunae DSM 20147
106 1610688 1610828 + NZ_CP015449.1 Dietzia lutea
107 2583439 2583570 - NZ_CP034463.1 Streptomyces aquilus
108 1476989 1477123 - NC_012590.1 Corynebacterium aurimucosum ATCC 700975
109 1393096 1393236 - NZ_CP009247.1 Corynebacterium frankenforstense DSM 45800
110 5690420 5690551 - NZ_CP016174.1 Amycolatopsis orientalis
111 1179558 1179698 + NC_015673.1 Corynebacterium resistens DSM 45100
112 963912 964052 + NZ_CP046883.1 Corynebacterium anserum
113 6217976 6218098 + NZ_CP022310.1 Streptomyces calvus
114 4079475 4079612 - NC_015312.1 Pseudonocardia dioxanivorans CB1190
115 5843305 5843427 - NC_013729.1 Kribbella flavida DSM 17836
116 6384036 6384158 + NZ_CP048882.1 Streptomyces bathyalis
117 931434 931565 - NZ_CP069485.1 Corynebacterium glucuronolyticum
118 1390481 1390621 + NZ_CP006764.1 Corynebacterium doosanense CAU 212 = DSM 45436
119 1396158 1396298 + NC_021915.1 Corynebacterium maris DSM 45190
120 1967451 1967576 - NZ_CP006842.1 Corynebacterium glyciniphilum AJ 3170
121 1623322 1623477 + NZ_AP017369.1 Corynebacterium suranareeae
122 1011725 1011865 + NC_012704.1 Corynebacterium kroppenstedtii DSM 44385
123 7445685 7445816 + NZ_CP032427.1 Streptomyces griseorubiginosus
124 1644424 1644564 + NZ_CP011542.1 Corynebacterium mustelae
125 1637243 1637374 - NZ_CP023703.1 Streptomyces galilaeus
126 7341058 7341180 + NZ_CP023688.1 Streptomyces rimosus
127 1342693 1342815 - NZ_CP020563.1 Kitasatospora albolonga
128 6268539 6268670 + NZ_LN831790.1 Streptomyces leeuwenhoekii
129 2531365 2531496 - NZ_CP047020.1 Streptomyces broussonetiae
130 2308262 2308393 - NZ_CP034539.1 Streptomyces cyaneochromogenes
131 1902284 1902415 - NZ_CP010849.1 Streptomyces cyaneogriseus subsp. noncyanogenus
132 2506024 2506146 - NZ_CP020569.1 Streptomyces gilvosporeus
133 6643546 6643668 + NZ_CP032698.1 Streptomyces hundungensis
134 8934162 8934314 + NZ_CP031142.1 Saccharopolyspora pogona
135 7666925 7667056 + NZ_CP022744.1 Streptomyces lincolnensis
136 7113678 7113800 + NZ_CP060404.1 Streptomyces buecherae
137 7688924 7689055 + NZ_CP023689.1 Streptomyces chartreusis
138 1852594 1852716 - NZ_CP045096.1 Streptomyces phaeolivaceus
139 7932440 7932562 + NC_013929.1 Streptomyces scabiei 87.22
140 2741669 2741815 - NC_013159.1 Saccharomonospora viridis DSM 43017
141 1559226 1559357 - NZ_CP020700.1 Streptomyces tsukubensis
142 7402210 7402332 + NZ_AP023440.1 Streptomyces glomeroaurantiacus
143 5775256 5775387 + NZ_CP023701.1 Streptomyces subrutilus
144 2153921 2154043 - NZ_CP023694.1 Streptomyces coeruleorubidus
145 1379835 1379966 - NZ_CP042266.1 Streptomyces qinzhouensis
146 3088894 3089025 - NZ_CP015163.1 Amycolatopsis albispora
147 7780308 7780430 + NC_003155.5 Streptomyces avermitilis MA-4680 = NBRC 14893
148 2809601 2809723 - NZ_CP070326.1 Streptomyces noursei
149 7139127 7139249 + NZ_CP045643.1 Streptomyces fagopyri
150 2927142 2927264 - NZ_CP031455.1 Streptomyces olivoreticuli subsp. olivoreticuli
151 2005748 2005870 - NZ_CP021978.1 Streptomyces hawaiiensis
152 1225351 1225482 - NZ_CP032229.1 Streptomyces seoulensis
153 1692570 1692692 - NZ_CP023407.1 Streptomyces fungicidicus
154 2460934 2461065 - NZ_CP023690.1 Streptomyces spectabilis
155 2166562 2166684 - NZ_CP027306.1 Streptomyces atratus
156 6675181 6675312 + NZ_CP011340.1 Streptomyces pristinaespiralis
157 6840878 6841000 + NZ_CP026652.1 Streptomyces dengpaensis
158 7537817 7537948 + NZ_CP017248.1 Streptomyces fodineus
159 5731258 5731380 - NZ_CP051486.1 Streptomyces pratensis
160 1531023 1531145 - NC_021177.1 Streptomyces fulvissimus DSM 40593
161 2208058 2208189 - NZ_CP071839.1 Streptomyces cyanogenus
162 2169368 2169499 - NC_021985.1 Streptomyces collinus Tu 365
163 1753698 1753820 - NZ_CP040752.1 Streptomyces rectiverticillatus
164 4290536 4290670 - NZ_AP018920.1 Pseudonocardia autotrophica
165 2059256 2059378 - NZ_CP015098.1 Streptomyces qaidamensis
166 3849484 3849618 + NC_009664.2 Kineococcus radiotolerans SRS30216 = ATCC BAA-149
167 2400922 2401077 + NZ_CP068161.1 Corynebacterium propinquum
168 1337808 1337963 + NZ_LT906467.1 Corynebacterium imitans
169 1277074 1277196 - NZ_CP024957.1 Streptomyces cavourensis
170 3063574 3063705 - NZ_CP065050.1 Streptomyces solisilvae
171 1792589 1792711 - NZ_CP063374.1 Streptomyces chromofuscus
172 1213885 1214028 - NZ_LT906473.1 Corynebacterium cystitidis
173 5640883 5641011 + NZ_CP065253.1 Streptomyces clavuligerus
174 2640150 2640296 - NZ_CP019066.1 Tsukamurella tyrosinosolvens
175 5542094 5542225 + NZ_CP031264.1 Streptacidiphilus bronchialis
176 8239459 8239590 - NZ_CP016279.1 Streptomyces griseochromogenes
177 1961016 1961147 - NZ_CP023698.1 Streptomyces viridifaciens
178 1436424 1436546 - NZ_AP023439.1 Streptomyces tuirus
179 2131579 2131737 - NC_014246.1 Mobiluncus curtisii ATCC 43063
180 1503472 1503609 + NC_020302.1 Corynebacterium halotolerans YIM 70093 = DSM 44683
181 5804189 5804320 + NZ_CP034279.1 Streptomyces ficellus
182 6549799 6549930 + NZ_CP051006.1 Streptomyces griseofuscus
183 1067960 1068082 - NC_016111.1 Streptomyces cattleya NRRL 8057 = DSM 46488
184 5607650 5607781 - NC_021252.1 Amycolatopsis keratiniphila
185 1320895 1321026 - NZ_CP021080.1 Streptomyces pluripotens
186 4444 4584 + NZ_CP007519.1 Trueperella pyogenes
187 6640205 6640324 - NC_013595.1 Streptosporangium roseum DSM 43021
188 2944003 2944134 + NZ_CP063373.1 Streptomyces ferrugineus
189 1500795 1500932 - NZ_CP009248.1 Corynebacterium sphenisci DSM 44792
190 2332272 2332406 - NC_014165.1 Thermobispora bispora DSM 43833
191 888612 888773 + NC_022198.1 Corynebacterium argentoratense DSM 44202
192 1649135 1649257 - NZ_CP029188.1 Streptomyces tirandamycinicus
193 8977189 8977320 - NZ_CP034550.1 Saccharothrix syringae
194 2065152 2065274 - NZ_CP022685.1 Streptomyces formicae
195 1253946 1254089 - NZ_CP041091.1 Nocardioides sambongensis
196 7852034 7852156 + NZ_CP023699.1 Streptomyces kanamyceticus
197 1238019 1238141 - NZ_CP029254.1 Streptomyces spongiicola
198 3014663 3014809 - NC_013441.1 Gordonia bronchialis DSM 43247
199 3321858 3321974 + NZ_CP012752.1 Kibdelosporangium phytohabitans
200 1198317 1198451 + NZ_CP011311.1 Corynebacterium camporealensis
201 1570852 1570992 - NZ_LR698967.1 Corynebacterium ammoniagenes
202 1270310 1270450 + NZ_CP011545.1 Corynebacterium testudinoris
203 1212582 1212719 + NZ_CP007790.1 Corynebacterium marinum DSM 44953
204 4490342 4490485 - NC_013235.1 Nakamurella multipartita DSM 44233
205 5698616 5698750 - NZ_CP053564.1 Pseudonocardia broussonetiae
206 5619740 5619886 - NC_008278.1 Frankia alni ACN14a
207 1221846 1222001 + NZ_CP011541.1 Corynebacterium epidermidicanis
208 2625911 2626054 - NZ_CP027433.1 Gordonia iterans
209 1224424 1224579 - NZ_CP008944.1 Corynebacterium atypicum
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LN831039.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF02463.21 0.99 206 982.5 same-strand RecF/RecN/SMC N terminal domain
2 PF20143.1 1.0 209 -3 same-strand ATP-NAD kinase C-terminal domain
3 PF13344.8 0.72 151 899 same-strand Haloacid dehalogenase-like hydrolase
4 PF13242.8 0.72 151 899 same-strand HAD-hyrolase-like
++ More..