Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01906 |
NCBI Accession ID | CP000480.1 |
Organism | Mycolicibacterium smegmatis MC2 155 |
Left | 6467128 |
Right | 6467259 |
Strand | - |
Nucleotide Sequence | GTGCCGCACGAACTCGACCTTCCAGGAGAAGTACATCGAGGCCGGTGGCAAGAACGGCGTGTTCAACTTCCCGCAGAGCGGTACGCACAACTGGGCGTACTGGGGCCAGCAGCTGCAGGCGATGAAGCCTGA |
Sequence | VPHELDLPGEVHRGRWQERRVQLPAERYAQLGVLGPAAAGDEA |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | 32181921 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 43 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 6484511 | 6484642 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
2 | 902400 | 902531 | - | NZ_CP012150.1 | Mycobacterium goodii |
3 | 2953166 | 2953297 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
4 | 489259 | 489390 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00501.30 | 1.0 | 4 | 2911.0 | same-strand | AMP-binding enzyme |
2 | PF00756.22 | 1.0 | 4 | 188.0 | same-strand | Putative esterase |
3 | PF01040.20 | 1.0 | 4 | 3692.0 | same-strand | UbiA prenyltransferase family |
4 | PF01569.23 | 1.0 | 4 | 4645.5 | same-strand | PAP2 superfamily |