Result : EXP01906
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01906 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 6467128 |
| Right | 6467259 |
| Strand | - |
| Nucleotide Sequence | GTGCCGCACGAACTCGACCTTCCAGGAGAAGTACATCGAGGCCGGTGGCAAGAACGGCGTGTTCAACTTCCCGCAGAGCGGTACGCACAACTGGGCGTACTGGGGCCAGCAGCTGCAGGCGATGAAGCCTGA |
| Sequence | VPHELDLPGEVHRGRWQERRVQLPAERYAQLGVLGPAAAGDEA |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6484511 | 6484642 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 902400 | 902531 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 2953166 | 2953297 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 4 | 489259 | 489390 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00501.30 | 1.0 | 4 | 2911.0 | same-strand | AMP-binding enzyme |
| 2 | PF00756.22 | 1.0 | 4 | 188.0 | same-strand | Putative esterase |
| 3 | PF01040.20 | 1.0 | 4 | 3692.0 | same-strand | UbiA prenyltransferase family |
| 4 | PF01569.23 | 1.0 | 4 | 4645.5 | same-strand | PAP2 superfamily |
++ More..