Result : EXP01903
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01903 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 4733897 |
| Right | 4734022 |
| Strand | - |
| Nucleotide Sequence | GTGACGAAAACCACAGTTTTGTCTCGAACCCGGCTCCAACACGTCAGTGAACTGGGGATACCGGTATGTTGCGCCCGCGTGTCGTGGGGGCGAGCGGTGAGGTCGAGCCTAAGAGCAATGCAATAA |
| Sequence | VTKTTVLSRTRLQHVSELGIPVCCARVSWGRAVRSSLRAMQ |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4734859 | 4734984 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 3681528 | 3681653 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 4115755 | 4115880 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 4 | 3515684 | 3515809 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06737.16 | 1.0 | 4 | 5088.5 | same-strand | Transglycosylase-like domain |
| 2 | PF12804.9 | 1.0 | 4 | 3224.5 | same-strand | MobA-like NTP transferase domain |
| 3 | PF02775.23 | 1.0 | 4 | 2068.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 4 | PF01855.21 | 1.0 | 4 | 118.0 | same-strand | Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg |
| 5 | PF01558.20 | 1.0 | 4 | 118.0 | same-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
| 6 | PF00356.23 | 0.75 | 3 | 1080 | same-strand | Bacterial regulatory proteins, lacI family |
| 7 | PF05721.15 | 0.75 | 3 | 2169 | opposite-strand | Phytanoyl-CoA dioxygenase (PhyH) |
| 8 | PF02894.19 | 0.75 | 3 | 3362 | opposite-strand | Oxidoreductase family, C-terminal alpha/beta domain |
| 9 | PF01408.24 | 0.75 | 3 | 3362 | opposite-strand | Oxidoreductase family, NAD-binding Rossmann fold |
++ More..