Result : B3DVZ6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000975.1 |
| Organism | Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4)) |
| Left | 1348616 |
| Right | 1348894 |
| Strand | - |
| Nucleotide Sequence | ATGCCCAATACAAAATCGGCTGAAAAGCATCAGCGGAAAAGTCAAAGAAAAAGAATTTTTAATCTTAGAGCAAAAAAAGAATTAAAAGAGCAGATTAAGCAGCTCAAGGATTTGATCGAAGCCAAAAAAAAGCAAGAAGCCTTAGCTTTTTTCCCCAAAATTCAATCTTTGCTCGATCGATTGGTAAAAAGAAAAAAGCTCGTGGCTAATAATGCCAATCGAAAAAAAAGAAGGTTGTTGGAGAAAATAGAAAAAATAACCGGTGATGGAATCTCTTGA |
| Sequence | MPNTKSAEKHQRKSQRKRIFNLRAKKELKEQIKQLKDLIEAKKKQEALAFFPKIQSLLDRLVKRKKLVANNANRKKRRLLEKIEKITGDGIS |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 18593465 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B3DVZ6 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1348616 | 1348894 | - | NC_010794.1 | Methylacidiphilum infernorum V4 |
| 2 | 1448585 | 1448854 | - | NZ_CP037899.1 | Methylacidiphilum kamchatkense Kam1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010794.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00163.21 | 1.0 | 2 | 2061.0 | same-strand | Ribosomal protein S4/S9 N-terminal domain |
| 2 | PF01479.27 | 1.0 | 2 | 2061.0 | same-strand | S4 domain |
| 3 | PF00411.21 | 1.0 | 2 | 1521.5 | same-strand | Ribosomal protein S11 |
| 4 | PF00416.24 | 1.0 | 2 | 1067.5 | same-strand | Ribosomal protein S13/S18 |
| 5 | PF00557.26 | 1.0 | 2 | 86.5 | same-strand | Metallopeptidase family M24 |
| 6 | PF00750.21 | 1.0 | 2 | 145.0 | opposite-strand | tRNA synthetases class I (R) |
| 7 | PF05746.17 | 1.0 | 2 | 145.0 | opposite-strand | DALR anticodon binding domain |
| 8 | PF03485.18 | 1.0 | 2 | 145.0 | opposite-strand | Arginyl tRNA synthetase N terminal domain |
| 9 | PF07730.15 | 1.0 | 2 | 2220.5 | opposite-strand | Histidine kinase |
| 10 | PF00989.27 | 1.0 | 2 | 2220.5 | opposite-strand | PAS fold |
| 11 | PF13426.9 | 1.0 | 2 | 2220.5 | opposite-strand | PAS domain |
| 12 | PF02518.28 | 1.0 | 2 | 2220.5 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 13 | PF08448.12 | 1.0 | 2 | 2220.5 | opposite-strand | PAS fold |
| 14 | PF00072.26 | 1.0 | 2 | 3320.0 | opposite-strand | Response regulator receiver domain |
| 15 | PF00196.21 | 1.0 | 2 | 3320.0 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 16 | PF08281.14 | 1.0 | 2 | 3320.0 | opposite-strand | Sigma-70, region 4 |
++ More..