Result : EXP01899
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01899 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 5497661 |
| Right | 5497774 |
| Strand | - |
| Nucleotide Sequence | GTGGTCGACCTTTCGGATGTGATGGGTGCCTCCGGGTCGACGATCGGCTCGGAGGACGCAGGGGAGGAAGCGCGGCCCGGCTTCAGGAAGAGCGCGAGCACGACGACGATGTAG |
| Sequence | VVDLSDVMGASGSTIGSEDAGEEARPGFRKSASTTTM |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5504621 | 5504743 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 2887905 | 2888018 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 4933134 | 4933262 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04417.14 | 1.0 | 3 | 3813 | same-strand | Protein of unknown function (DUF501) |
| 2 | PF04977.17 | 1.0 | 3 | 3142 | same-strand | Septum formation initiator |
| 3 | PF00113.24 | 1.0 | 3 | 1817 | same-strand | Enolase, C-terminal TIM barrel domain |
| 4 | PF03952.18 | 1.0 | 3 | 1817 | same-strand | Enolase, N-terminal domain |
| 5 | PF03239.16 | 1.0 | 3 | -122 | opposite-strand | Iron permease FTR1 family |
| 6 | PF09375.12 | 1.0 | 3 | 7 | opposite-strand | Imelysin |
| 7 | PF13473.8 | 1.0 | 3 | 7 | opposite-strand | Cupredoxin-like domain |
| 8 | PF04261.14 | 1.0 | 3 | 1154 | opposite-strand | Dyp-type peroxidase family |
| 9 | PF03819.19 | 1.0 | 3 | 6132 | same-strand | MazG nucleotide pyrophosphohydrolase domain |
++ More..