Result : EXP01897
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01897 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 1523457 |
| Right | 1523567 |
| Strand | - |
| Nucleotide Sequence | ATGCGTTCGAGCTCGTCGATGATGTCCTTGCACTGCTGCGTCGACAACTCCCGCGGGTCGCGCTTGCCCGACGAGGACAGGCAGTGGACACACGCGAGGTTGCACGCGTAG |
| Sequence | MRSSSSMMSLHCCVDNSRGSRLPDEDRQWTHARLHA |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 101
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1598372 | 1598482 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 6788612 | 6788722 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 1182313 | 1182423 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 4 | 4708652 | 4708762 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 5 | 3946063 | 3946173 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 6 | 1138597 | 1138707 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 7 | 5214898 | 5215008 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 8 | 31369 | 31479 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 9 | 2439333 | 2439443 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 10 | 3874498 | 3874608 | + | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 11 | 4228902 | 4229012 | + | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 12 | 4159238 | 4159348 | + | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 13 | 985896 | 986006 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 14 | 3948245 | 3948355 | - | NZ_LS483468.1 | Rhodococcus coprophilus |
| 15 | 4386477 | 4386587 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 16 | 3246041 | 3246151 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 17 | 3931804 | 3931914 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 18 | 1464384 | 1464494 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 19 | 3290845 | 3290955 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 20 | 2913347 | 2913457 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 21 | 622705 | 622815 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 22 | 2854185 | 2854274 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 23 | 3557008 | 3557097 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 24 | 5306274 | 5306384 | - | NZ_CP033972.1 | Gordonia insulae |
| 25 | 4026178 | 4026288 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 26 | 3999665 | 3999775 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 27 | 4065200 | 4065292 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 28 | 4391151 | 4391261 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 29 | 3723241 | 3723351 | + | NZ_CP029146.1 | Rhodococcus ruber |
| 30 | 1071922 | 1072032 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 31 | 5494256 | 5494366 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 32 | 2703093 | 2703203 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 33 | 2452619 | 2452729 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 34 | 1112911 | 1113021 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 35 | 3259866 | 3259976 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 36 | 2481460 | 2481570 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 37 | 3889923 | 3890033 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 38 | 226518 | 226610 | - | NZ_CP064760.1 | Microbacterium schleiferi |
| 39 | 845087 | 845197 | - | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 40 | 4473357 | 4473467 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 41 | 1649719 | 1649829 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 42 | 2491107 | 2491199 | + | NZ_CP015449.1 | Dietzia lutea |
| 43 | 615553 | 615663 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 44 | 4073277 | 4073387 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 45 | 6061530 | 6061622 | + | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 46 | 6462599 | 6462709 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 47 | 5903318 | 5903428 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 48 | 581889 | 581999 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 49 | 3724551 | 3724643 | - | NZ_CP041146.1 | Nocardioides humi |
| 50 | 2662550 | 2662660 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 51 | 1270569 | 1270679 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 52 | 2705851 | 2705961 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 53 | 2684853 | 2684945 | + | NZ_CP015453.1 | Dietzia psychralcaliphila |
| 54 | 6950812 | 6950922 | + | NZ_LR134352.1 | Nocardia asteroides |
| 55 | 2386154 | 2386264 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 56 | 3587146 | 3587256 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 57 | 2230279 | 2230371 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 58 | 4465099 | 4465209 | - | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 59 | 6537300 | 6537410 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 60 | 1145110 | 1145220 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 61 | 7409456 | 7409566 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 62 | 290945 | 291055 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 63 | 2488934 | 2489044 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 64 | 3172735 | 3172845 | + | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 65 | 1726933 | 1727043 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 66 | 2412326 | 2412418 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 67 | 3645625 | 3645717 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 68 | 3413133 | 3413225 | + | NZ_CP011853.1 | Gordonia phthalatica |
| 69 | 4008961 | 4009071 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 70 | 3765793 | 3765903 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 71 | 2715119 | 2715229 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 72 | 2466109 | 2466219 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 73 | 3718268 | 3718378 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 74 | 1381313 | 1381423 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 75 | 1388746 | 1388856 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 76 | 3651637 | 3651747 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 77 | 3499853 | 3499945 | + | NZ_AP023396.1 | Nocardia wallacei |
| 78 | 1849605 | 1849694 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 79 | 5035924 | 5036016 | - | NZ_CP009896.1 | Pimelobacter simplex |
| 80 | 3557550 | 3557660 | + | NC_015576.1 | Mycolicibacter sinensis |
| 81 | 3538821 | 3538931 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 82 | 2925496 | 2925606 | - | NZ_AP022562.1 | Mycobacterium novum |
| 83 | 4398586 | 4398696 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 84 | 3065295 | 3065387 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 85 | 3953213 | 3953317 | - | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 86 | 3870655 | 3870765 | - | NC_008278.1 | Frankia alni ACN14a |
| 87 | 5548449 | 5548559 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 88 | 4727117 | 4727227 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 89 | 5019759 | 5019869 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 90 | 1222175 | 1222285 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 91 | 2995867 | 2995977 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 92 | 804054 | 804164 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 93 | 792237 | 792347 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 94 | 2754371 | 2754463 | + | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 95 | 2186136 | 2186228 | - | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 96 | 1429864 | 1429974 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 97 | 2591418 | 2591510 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 98 | 544520 | 544630 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 99 | 1291757 | 1291849 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 100 | 3543176 | 3543286 | - | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 101 | 473760 | 473852 | - | NC_013524.1 | Sphaerobacter thermophilus DSM 20745 |
| 102 | 1686791 | 1686901 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 103 | 2866721 | 2866813 | + | NC_017093.1 | Actinoplanes missouriensis 431 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17754.3 | 0.85 | 86 | 600.0 | same-strand | MftR C-terminal domain |
| 2 | PF00440.25 | 0.87 | 88 | 605.0 | same-strand | Bacterial regulatory proteins, tetR family |
| 3 | PF04055.23 | 1.0 | 101 | -110 | opposite-strand | Radical SAM superfamily |
| 4 | PF13186.8 | 0.94 | 95 | -110 | opposite-strand | Iron-sulfur cluster-binding domain |
| 5 | PF01070.20 | 0.9 | 91 | 1002.0 | opposite-strand | FMN-dependent dehydrogenase |
| 6 | PF02633.16 | 0.8 | 81 | 2353 | opposite-strand | Creatinine amidohydrolase |
| 7 | PF13641.8 | 0.8 | 81 | 3056 | opposite-strand | Glycosyltransferase like family 2 |
| 8 | PF13632.8 | 0.77 | 78 | 3055.0 | opposite-strand | Glycosyl transferase family group 2 |
| 9 | PF13506.8 | 0.73 | 74 | 3055.5 | opposite-strand | Glycosyl transferase family 21 |
| 10 | PF00732.21 | 0.66 | 67 | 4486 | opposite-strand | GMC oxidoreductase |
| 11 | PF05199.15 | 0.68 | 69 | 4489 | opposite-strand | GMC oxidoreductase |
++ More..