ProsmORF-pred
Result : EXP01896
Protein Information
Information Type Description
Protein name EXP01896
NCBI Accession ID CP000480.1
Organism Mycolicibacterium smegmatis MC2 155
Left 141740
Right 141850
Strand -
Nucleotide Sequence ATGGATCCGAATCCTGACTACGATCTCAGCGACGAAGGCGAGTTCTTCTTCAACTGGATCCCGTGGGGCCTTCGTGGCGTGTACCCGCCGCCGGCCTATCCCCCGGTGTAA
Sequence MDPNPDYDLSDEGEFFFNWIPWGLRGVYPPPAYPPV
Source of smORF Transcriptional-level
Function
Pubmed ID 32181921
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 36
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 40
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 156434 156544 - NZ_LN831039.1 Mycolicibacterium smegmatis
2 576337 576447 + NZ_LN831039.1 Mycolicibacterium smegmatis
3 1721596 1721706 - NZ_AP022595.1 Mycolicibacterium sarraceniae
4 89062 89172 + NZ_AP022611.1 Mycolicibacterium madagascariense
5 997476 997592 + NZ_AP022619.1 Mycobacterium paraseoulense
6 6135937 6136062 - NZ_AP022613.1 Mycobacterium conspicuum
7 5307399 5307503 + NZ_AP022616.1 Mycolicibacterium phocaicum
8 1869670 1869795 + NZ_AP022615.1 Mycobacterium heidelbergense
9 1710888 1711016 + NZ_AP022582.1 Mycobacterium seoulense
10 2523737 2523847 - NZ_AP022576.1 Mycobacterium florentinum
11 1877317 1877427 - NZ_AP022576.1 Mycobacterium florentinum
12 5760507 5760617 + NZ_AP022576.1 Mycobacterium florentinum
13 2064868 2064978 + NZ_CP012150.1 Mycobacterium goodii
14 3580849 3580950 + NZ_AP022609.1 Mycolicibacter hiberniae
15 1972009 1972110 - NZ_AP022589.1 Mycolicibacter minnesotensis
16 718996 719112 - NZ_AP024310.1 Mycobacterium heckeshornense
17 5636902 5637012 + NZ_AP022561.1 Mycolicibacterium aichiense
18 3395303 3395413 - NZ_LT906483.1 Mycolicibacterium thermoresistibile
19 4453881 4453991 - NZ_AP022620.1 Mycolicibacterium anyangense
20 2553340 2553456 - NZ_LT906469.1 Mycolicibacter terrae
21 1458296 1458427 - NZ_AP022618.1 Mycolicibacterium insubricum
22 2156210 2156320 + NZ_AP022596.1 Mycolicibacterium helvum
23 1865664 1865774 - NZ_AP022573.1 Mycobacterium saskatchewanense
24 4579907 4580017 + NZ_AP022573.1 Mycobacterium saskatchewanense
25 1179223 1179333 + NZ_AP022600.1 Mycolicibacterium tokaiense
26 4807870 4807980 + NZ_AP022612.1 Mycolicibacterium confluentis
27 4721907 4722017 + NZ_LR134355.1 Mycolicibacterium chitae
28 6031499 6031609 + NZ_AP022587.1 Mycobacterium stomatepiae
29 1416166 1416294 + NZ_AP022569.1 Mycobacterium cookii
30 3071653 3071766 + NZ_CP029543.1 Mycobacterium leprae
31 99965 100066 - NC_015576.1 Mycolicibacter sinensis
32 1857872 1857973 + NZ_AP022562.1 Mycobacterium novum
33 749546 749656 + NZ_AP022574.1 Mycolicibacterium psychrotolerans
34 1587903 1588013 - NZ_LR134356.1 Mycolicibacterium aurum
35 117253 117363 - NZ_LR134356.1 Mycolicibacterium aurum
36 3063056 3063166 + NZ_AP022601.1 Mycobacterium gallinarum
37 4674791 4674901 - NZ_AP022601.1 Mycobacterium gallinarum
38 721814 721924 - NZ_AP022570.1 Mycolicibacterium poriferae
39 4354696 4354806 + NZ_AP022563.1 Mycolicibacterium duvalii
40 296338 296448 + NZ_AP022560.1 Mycolicibacterium moriokaense
41 121903 122013 - NZ_CP011491.1 Mycolicibacterium vaccae 95051
42 2243385 2243495 + NZ_AP022599.1 Mycolicibacterium pulveris
43 1332363 1332473 + NZ_AP022598.1 Mycolicibacterium parafortuitum
44 4491906 4492016 - NZ_AP022608.1 Mycolicibacterium gadium
45 138398 138508 - NC_008726.1 Mycolicibacterium vanbaalenii PYR-1
46 4382012 4382122 + NZ_LR026975.1 Mycolicibacterium hassiacum DSM 44199
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LN831039.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF17932.3 0.68 27 148 opposite-strand Tetracyclin repressor-like, C-terminal domain
2 PF00440.25 0.7 28 162.5 opposite-strand Bacterial regulatory proteins, tetR family
++ More..