Result : EXP01894
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01894 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 153225 |
| Right | 153326 |
| Strand | - |
| Nucleotide Sequence | GTGAAGATGATGAGCACCGTCAGCGGGATCGACACCGCAAGCGTCGGCAGGAAGGCCACGCGGATGAGAAACCAGCTCTGGAGGACGAACTCTTTCCACTGA |
| Sequence | VKMMSTVSGIDTASVGRKATRMRNQLWRTNSFH |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 167919 | 168020 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 5527980 | 5528081 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 3 | 62722 | 62823 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 4 | 1324136 | 1324237 | + | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 5 | 4047848 | 4047949 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 6 | 5768614 | 5768715 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 7 | 2600817 | 2600918 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 8 | 1113051 | 1113152 | - | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 9 | 2413835 | 2413936 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 10 | 2838003 | 2838104 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 11 | 531543 | 531644 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 12 | 2671014 | 2671097 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 13 | 5776238 | 5776339 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 14 | 213530 | 213631 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 15 | 4072905 | 4073006 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 16 | 4463436 | 4463537 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 17 | 2476085 | 2476186 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 18 | 2021334 | 2021447 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 19 | 1007683 | 1007784 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 20 | 1322321 | 1322422 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 21 | 2241865 | 2241948 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 22 | 3658862 | 3658963 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 23 | 3158818 | 3158916 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 24 | 482216 | 482317 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 25 | 6108387 | 6108488 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 26 | 6161864 | 6161965 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 27 | 5903796 | 5903897 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 28 | 581381 | 581482 | - | NZ_AP023396.1 | Nocardia wallacei |
| 29 | 804611 | 804712 | - | NZ_CP015961.1 | Dietzia timorensis |
| 30 | 4282440 | 4282526 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022565.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02405.18 | 1.0 | 26 | 242.5 | opposite-strand | Permease MlaE |
| 2 | PF11887.10 | 1.0 | 26 | 2626.5 | opposite-strand | Cholesterol uptake porter CUP1 of Mce4, putative |
| 3 | PF02470.22 | 1.0 | 26 | 2758 | opposite-strand | MlaD protein |
| 4 | PF13561.8 | 0.65 | 17 | 1558.5 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 5 | PF00106.27 | 0.65 | 17 | 1876 | same-strand | short chain dehydrogenase |
++ More..