Protein Information |
Information Type | Description |
---|---|
Protein name | Prokaryotic ubiquitin-like protein UBact |
NCBI Accession ID | CP000975.1 |
Organism | Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4)) |
Left | 1197983 |
Right | 1198180 |
Strand | - |
Nucleotide Sequence | ATGGAGGTAAATATGCCCACAACTGAACAAGGACAAAAAAACAAGCAGATGATTCCTTCTCCAGGCCCCGGCGGAGGAAGTGGACCGGGCCCTCAGGCTCCAAAGGTGGAAAAGCCCAATACCGAGGAAATACTGAAACGCATGCGTAAAGTTGACCCTGACCAGGCACGTCGGTACAGGCAGAGGACTGGAGAGTGA |
Sequence | MEVNMPTTEQGQKNKQMIPSPGPGGGSGPGPQAPKVEKPNTEEILKRMRKVDPDQARRYRQRTGE |
Source of smORF | Swiss-Prot |
Function | May function as a protein modifier covalently attached to lysine residues of substrate proteins. This may serve to target the modified proteins for degradation by proteasomes. {ECO:0000305|Pubmed:28087277}. |
Pubmed ID | 18593465 28087277 |
Domain | |
Functional Category | Others |
Uniprot ID | B3DVI3 |
ORF Length (Amino Acid) | 65 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1197983 | 1198180 | - | NC_010794.1 | Methylacidiphilum infernorum V4 |
2 | 1258230 | 1258427 | - | NZ_CP037899.1 | Methylacidiphilum kamchatkense Kam1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00886.21 | 1.0 | 2 | 4701.0 | same-strand | Ribosomal protein S16 |
2 | PF00448.24 | 1.0 | 2 | 3276.0 | same-strand | SRP54-type protein, GTPase domain |
3 | PF02978.21 | 1.0 | 2 | 3276.0 | same-strand | Signal peptide binding domain |
4 | PF02881.21 | 1.0 | 2 | 3276.0 | same-strand | SRP54-type protein, helical bundle domain |
5 | PF03136.17 | 1.0 | 2 | 917.5 | same-strand | Pup-ligase protein |
6 | PF00227.28 | 1.0 | 2 | -3.0 | same-strand | Proteasome subunit |
7 | PF00004.31 | 1.0 | 2 | 1599.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
8 | PF17758.3 | 1.0 | 2 | 1599.0 | same-strand | Proteasomal ATPase OB N-terminal domain |
9 | PF16450.7 | 1.0 | 2 | 1599.0 | same-strand | Proteasomal ATPase OB C-terminal domain |
10 | PF00215.26 | 1.0 | 2 | 3356.0 | same-strand | Orotidine 5'-phosphate decarboxylase / HUMPS family |
11 | PF00288.28 | 1.0 | 2 | 4101.0 | opposite-strand | GHMP kinases N terminal domain |
12 | PF07992.16 | 1.0 | 2 | 4972.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
13 | PF00070.29 | 1.0 | 2 | 4972.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |