Result : B3CQT8

Protein Information

• Protein name: ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein)
• NCBI Accession ID: AP008981.1
• Organism: Orientia tsutsugamushi (strain Ikeda) (Rickettsia tsutsugamushi)
• Left: 400962
• Right: 401186
• Strand: -
• Nucleotide Sequence: ATGGACCCTATATCTTTTAAGTACATAGCTATAGCTTTCATGGCATTTGGCATGGCTGGAGCAGCATTAGGAGTTGCAAGCATATTTAATGCACTGATGAATTCTATAGCACGTAACCCTTCAGCTATTGAAGATTTACAGAAAGCTGCTTTAATTGGAGCTGGACTAGCTGAAGCTATGGGTTTGTTTTCATTTATTTTGGCAATATTATTAATGTTTACTTAA
• Sequence: MDPISFKYIAIAFMAFGMAGAALGVASIFNALMNSIARNPSAIEDLQKAALIGAGLAEAMGLFSFILAILLMFT
• Source of smORF: Swiss-Prot
• Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}.
• Pubmed ID: 18508905
• Domain: CDD:412393
• Functional Category: Others
• Uniprot ID: B3CQT8
• ORF Length (Amino Acid): 74

Conservation Analysis

No. of Species: 16

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1392481	1392705	+	NC_007940.1	Rickettsia bellii RML369-C
2	22188	22412	-	NC_017049.1	Rickettsia prowazekii str. Chernikova
3	48390	48614	-	NC_017058.1	Rickettsia australis str. Cutlack
4	34333	34557	-	NZ_AP019563.1	Rickettsia asiatica
5	296083	296307	+	NZ_LN794217.1	Rickettsia monacensis
6	30381	30605	-	NZ_AP019864.1	Rickettsia heilongjiangensis
7	29686	29910	-	NC_010263.3	Rickettsia rickettsii str. Iowa
8	27178	27402	-	NC_003103.1	Rickettsia conorii str. Malish 7
9	30425	30649	-	NC_016639.1	Rickettsia slovaca 13-B
10	140141	140365	+	NC_017066.1	Rickettsia typhi str. TH1527
11	35388	35612	+	NC_009881.1	Rickettsia akari str. Hartford
12	22868	23092	-	NC_016929.1	Rickettsia canadensis str. CA410
13	327213	327440	+	NZ_CP007481.1	Neorickettsia helminthoeca str. Oregon
14	323916	324143	+	NC_007798.1	Neorickettsia sennetsu str. Miyayama
15	322611	322838	+	NZ_CP047224.1	Neorickettsia findlayensis
16	335076	335303	+	NC_013009.1	Neorickettsia risticii str. Illinois

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_017049.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02559.18	0.75	12	2300.0	opposite-strand	CarD-like/TRCF domain
2	PF13462.8	0.75	12	1303.0	same-strand	Thioredoxin
3	PF09527.12	0.75	12	912.0	same-strand	Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter
4	PF00119.22	1.0	16	35.0	same-strand	ATP synthase A chain
5	PF02326.17	1.0	16	18.5	same-strand	Plant ATP synthase F0
6	PF00430.20	1.0	16	487.0	same-strand	ATP synthase B/B' CF(0)
7	PF05405.16	0.69	11	485.5	same-strand	Mitochondrial ATP synthase B chain precursor (ATP-synt B)
8	PF10119.11	0.69	11	3068	same-strand	Predicted methyltransferase regulatory domain
9	PF08242.14	0.69	11	3068	same-strand	Methyltransferase domain
10	PF13649.8	0.69	11	3068	same-strand	Methyltransferase domain
11	PF08241.14	0.69	11	3068	same-strand	Methyltransferase domain