| Protein name |
Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID |
AP008981.1 |
| Organism |
Orientia tsutsugamushi (strain Ikeda) (Rickettsia tsutsugamushi) |
| Left |
375327 |
| Right |
375626 |
| Strand |
- |
| Nucleotide Sequence |
ATGATATCTATAAATGAAGTGCAATCAATTGCTAATTACTGCAAGTTGCGGTTTAATGAACAAGAACTAAATCATATGGTTAAGCAACTATCCAGTATAGTGGAAATGATGAACAAGCTGGAAAAAATTGATTGTACATCTGTTCCACCTATGAGGCACTTTGAAGAAAATAACAGAATGCGAAAAGATCAAGTTGAGCAGAATATTACAGTGGATCAGTTATTATCTAACGTACCACAGTCATCAGCAACTATAGCTAAAAACACAAAATATTTTGTTGTACCAAAGATAATAGAATAA |
| Sequence |
MISINEVQSIANYCKLRFNEQELNHMVKQLSSIVEMMNKLEKIDCTSVPPMRHFEENNRMRKDQVEQNITVDQLLSNVPQSSATIAKNTKYFVVPKIIE |
| Source of smORF |
Swiss-Prot |
| Function |
Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID |
18508905
|
| Domain |
CDD:412411 |
| Functional Category |
Others |
| Uniprot ID |
B3CQR0
|
| ORF Length (Amino Acid) |
99 |