Result : B3CQD5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | AP008981.1 |
| Organism | Orientia tsutsugamushi (strain Ikeda) (Rickettsia tsutsugamushi) |
| Left | 20716 |
| Right | 20922 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTACCTAAAAAAAGAACTTCTGCATCTAAGACAAGAATGCGCAGATCACACCATGCATTAGCTAAGGTAAATGTTATCACAGATGCAAAAACAGGAGAATATAGACTCTCGCACCATGTATGTATGACTCATGGAACTTATAATGGAAGGAAAGTTATCACGGATAATGTTAATACAAACGATAATAATAACAATTCTTAA |
| Sequence | MAVPKKRTSASKTRMRRSHHALAKVNVITDAKTGEYRLSHHVCMTHGTYNGRKVITDNVNTNDNNNNS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 18508905 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B3CQD5 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 98
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 346001 | 346201 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 2 | 1172615 | 1172809 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 3 | 994828 | 995028 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 4 | 88083 | 88283 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 5 | 963996 | 964193 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 6 | 1067380 | 1067580 | - | NC_009881.1 | Rickettsia akari str. Hartford |
| 7 | 1111178 | 1111378 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 8 | 963437 | 963634 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 9 | 1099983 | 1100183 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 10 | 1098392 | 1098592 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 11 | 1106470 | 1106670 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 12 | 145056 | 145256 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| 13 | 996916 | 997095 | + | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 14 | 1919654 | 1919836 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 15 | 2136301 | 2136483 | + | NZ_CP027850.1 | Caulobacter segnis |
| 16 | 1204701 | 1204889 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 17 | 299129 | 299305 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 18 | 2001719 | 2001904 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 19 | 803741 | 803917 | - | NC_012026.1 | Anaplasma marginale str. Florida |
| 20 | 783529 | 783705 | - | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 21 | 612945 | 613127 | - | NC_014817.1 | Asticcacaulis excentricus CB 48 |
| 22 | 2299250 | 2299426 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 23 | 1174604 | 1174786 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
| 24 | 1426018 | 1426200 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 25 | 1776610 | 1776798 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 26 | 1136158 | 1136340 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 27 | 2557118 | 2557300 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 28 | 1770767 | 1770940 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 29 | 1168109 | 1168291 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 30 | 2406832 | 2407014 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 31 | 2546822 | 2547004 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 32 | 1119629 | 1119814 | - | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 33 | 2093422 | 2093604 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 34 | 245826 | 246008 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 35 | 1958883 | 1959065 | - | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 36 | 2878497 | 2878682 | - | NC_014217.1 | Starkeya novella DSM 506 |
| 37 | 1310930 | 1311121 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 38 | 954292 | 954474 | + | NZ_CP024610.1 | Lactobacillus terrae |
| 39 | 745662 | 745853 | + | NZ_CP029476.1 | Lactobacillus apis |
| 40 | 1260957 | 1261148 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 41 | 1300661 | 1300852 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 42 | 295578 | 295769 | + | NZ_CP010522.1 | Liberibacter crescens |
| 43 | 2226730 | 2226912 | + | NZ_AP019700.1 | Stella humosa |
| 44 | 947673 | 947858 | + | NZ_CP049366.1 | Companilactobacillus pabuli |
| 45 | 1493078 | 1493263 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 46 | 1386963 | 1387148 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 47 | 1083089 | 1083271 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 48 | 1810654 | 1810827 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 49 | 1927299 | 1927481 | - | NZ_CP013002.1 | Caulobacter henricii |
| 50 | 1518673 | 1518855 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 51 | 381870 | 382052 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 52 | 568778 | 568969 | - | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 53 | 1837961 | 1838143 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 54 | 554089 | 554280 | - | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 55 | 1574868 | 1575050 | - | NZ_CP030126.1 | Indioceanicola profundi |
| 56 | 1670019 | 1670201 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 57 | 3114881 | 3115063 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 58 | 2112666 | 2112848 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 59 | 163866 | 164048 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 60 | 1816550 | 1816729 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 61 | 3866389 | 3866574 | - | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 62 | 157708 | 157890 | + | NZ_CP017940.1 | Phyllobacterium zundukense |
| 63 | 4079296 | 4079478 | - | NZ_CP026100.1 | Caulobacter flavus |
| 64 | 941297 | 941488 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 65 | 1845472 | 1845651 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 66 | 430844 | 431032 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 67 | 416260 | 416445 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 68 | 169594 | 169779 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 69 | 3034510 | 3034689 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 70 | 582857 | 583039 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 71 | 661046 | 661228 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 72 | 7703036 | 7703236 | + | NZ_CP042425.1 | Limnoglobus roseus |
| 73 | 1592794 | 1592976 | + | NZ_CP021781.1 | Francisella adeliensis |
| 74 | 983354 | 983554 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 75 | 716031 | 716210 | + | NZ_CP017715.1 | Marinobacter salinus |
| 76 | 753690 | 753878 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 77 | 927145 | 927333 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 78 | 1183277 | 1183465 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 79 | 2535379 | 2535549 | - | NZ_CP037951.1 | Parashewanella tropica |
| 80 | 1157162 | 1157350 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 81 | 4720782 | 4720976 | - | NZ_CP017480.1 | Luteibacter rhizovicinus DSM 16549 |
| 82 | 1804610 | 1804804 | - | NZ_LN614830.1 | Tatlockia micdadei |
| 83 | 2995006 | 2995200 | - | NZ_CP041046.1 | Luteibacter pinisoli |
| 84 | 1933811 | 1933993 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 85 | 3002477 | 3002647 | + | NZ_CP026364.1 | Proteus hauseri |
| 86 | 2937654 | 2937824 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 87 | 1880125 | 1880298 | - | NZ_CP013816.1 | Piscirickettsia salmonis |
| 88 | 1648073 | 1648252 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 89 | 2371068 | 2371250 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 90 | 145157 | 145348 | - | NZ_LR134428.1 | Legionella adelaidensis |
| 91 | 1789037 | 1789207 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 92 | 2175384 | 2175554 | - | NZ_LR134167.1 | Avibacterium volantium |
| 93 | 470854 | 471024 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 94 | 882959 | 883129 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 95 | 1621050 | 1621220 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 96 | 2301649 | 2301819 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 97 | 2347994 | 2348164 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 98 | 1812741 | 1812911 | - | NZ_CP016604.1 | Otariodibacter oris |
++ More..