Result : EXP01846
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01846 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 2407176 |
| Right | 2407322 |
| Strand | + |
| Nucleotide Sequence | ATGCGTAAGAATTGGCTTTCTCGACTGTCGGTCAAATATCGCCGCGCCTATCAACCGCACCCCCGCACGAGTGCCCGTGACGCGGATGCCCGCCGCGTGCACAGCGAACTCGACGCCATCCGCGCGCGATTCCCCGATCACGCGTGA |
| Sequence | MRKNWLSRLSVKYRRAYQPHPRTSARDADARRVHSELDAIRARFPDHA |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2477301 | 2477447 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 5973515 | 5973661 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 2333446 | 2333592 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 4 | 4888807 | 4888953 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 5 | 5407394 | 5407540 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 6 | 5423792 | 5423938 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 7 | 2134197 | 2134361 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 8 | 1658466 | 1658612 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 9 | 2933828 | 2933983 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 10 | 3633284 | 3633427 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 11 | 169166 | 169309 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 12 | 2527489 | 2527614 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 13 | 1172394 | 1172537 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 14 | 2225431 | 2225583 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 15 | 2035339 | 2035491 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 16 | 5382188 | 5382340 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 17 | 4682506 | 4682658 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 18 | 2053438 | 2053590 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01497.20 | 0.94 | 17 | 4993 | opposite-strand | Periplasmic binding protein |
| 2 | PF00115.22 | 1.0 | 18 | 3122.5 | same-strand | Cytochrome C and Quinol oxidase polypeptide I |
| 3 | PF12710.9 | 1.0 | 18 | 1851.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 4 | PF13740.8 | 0.89 | 16 | 1860.0 | same-strand | ACT domain |
| 5 | PF00702.28 | 1.0 | 18 | 1851.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 6 | PF13419.8 | 0.94 | 17 | 1859 | same-strand | Haloacid dehalogenase-like hydrolase |
| 7 | PF00155.23 | 1.0 | 18 | 64.0 | opposite-strand | Aminotransferase class I and II |
| 8 | PF00392.23 | 1.0 | 18 | 64.0 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 9 | PF00005.29 | 1.0 | 18 | 677.0 | same-strand | ABC transporter |
| 10 | PF00378.22 | 1.0 | 18 | 2357.0 | same-strand | Enoyl-CoA hydratase/isomerase |
| 11 | PF08241.14 | 0.94 | 17 | 3055 | same-strand | Methyltransferase domain |
| 12 | PF13649.8 | 0.94 | 17 | 3055 | same-strand | Methyltransferase domain |
| 13 | PF08242.14 | 0.94 | 17 | 3055 | same-strand | Methyltransferase domain |
++ More..