Result : EXP01841
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01841 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 892020 |
| Right | 892154 |
| Strand | + |
| Nucleotide Sequence | GTGGACCGGGACGCTCTGCAGATCCACGGCGAAGGCGTGGCCTTCACCGTCGGCCTGTACTCACAAGATCAGCGGGGACGCAACGGGATACCGGTCCGCGACGACCGCACCCGCCATCAGATCAGCCCACAGTGA |
| Sequence | VDRDALQIHGEGVAFTVGLYSQDQRGRNGIPVRDDRTRHQISPQ |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 928506 | 928640 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 268789 | 268923 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 3039069 | 3039203 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 4 | 2062189 | 2062323 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 5 | 781733 | 781867 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 6 | 578621 | 578740 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 7 | 3756412 | 3756528 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 8 | 4283199 | 4283315 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 9 | 259810 | 259926 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 10 | 4014202 | 4014321 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 11 | 1119624 | 1119743 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 12 | 1121081 | 1121191 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 13 | 1918593 | 1918712 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 14 | 1727178 | 1727294 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 15 | 980554 | 980694 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 16 | 1675514 | 1675633 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 17 | 4109801 | 4109917 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 18 | 5064105 | 5064215 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 19 | 2248235 | 2248378 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 20 | 3276139 | 3276264 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 21 | 5047553 | 5047687 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 22 | 4288834 | 4288965 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 23 | 4386351 | 4386482 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 24 | 4691651 | 4691761 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 25 | 2382143 | 2382286 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 26 | 2383612 | 2383743 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 27 | 4342683 | 4342814 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 28 | 2400625 | 2400762 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 29 | 4128233 | 4128364 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 30 | 494035 | 494154 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 31 | 4347429 | 4347560 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 32 | 3980959 | 3981078 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 33 | 2546585 | 2546695 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 34 | 4839768 | 4839899 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 35 | 3998999 | 3999130 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022565.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04389.19 | 0.88 | 28 | 0.0 | same-strand | Peptidase family M28 |
| 2 | PF02225.24 | 0.81 | 26 | 0.0 | same-strand | PA domain |
| 3 | PF05690.16 | 0.69 | 22 | 3415.5 | same-strand | Thiazole biosynthesis protein ThiG |
++ More..