Result : EXP01839
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01839 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 496059 |
| Right | 496187 |
| Strand | + |
| Nucleotide Sequence | GTGAGCCGGAACGCCAAGAGGAACGGCAGTGAGATGAACGCCATCGGGATGAACCACGGCAGGTCACCCACCCACTGGCCGAAGTGGCTGGACCCGGGCGCACACGCCGTGCTCACGCACGGCGAGTAG |
| Sequence | VSRNAKRNGSEMNAIGMNHGRSPTHWPKWLDPGAHAVLTHGE |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 474060 | 474188 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 1936117 | 1936245 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 7125423 | 7125551 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 4 | 2547048 | 2547176 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 5 | 3002978 | 3003106 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 6 | 5203403 | 5203531 | + | NZ_CP016353.1 | Prauserella marina |
| 7 | 7182321 | 7182449 | - | NZ_CP018082.1 | Nocardia mangyaensis |
| 8 | 3683485 | 3683613 | + | NZ_CP015163.1 | Amycolatopsis albispora |
| 9 | 3073068 | 3073196 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 10 | 107108 | 107233 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 11 | 4089542 | 4089667 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 12 | 323596 | 323721 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 13 | 1783630 | 1783758 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 14 | 6419879 | 6420004 | - | NZ_CP058322.1 | Micromonospora carbonacea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13085.8 | 1.0 | 14 | 2473.5 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 2 | PF13183.8 | 1.0 | 14 | 2473.5 | opposite-strand | 4Fe-4S dicluster domain |
| 3 | PF00111.29 | 1.0 | 14 | 2473.5 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 4 | PF13534.8 | 0.86 | 12 | 2476.0 | opposite-strand | 4Fe-4S dicluster domain |
| 5 | PF00890.26 | 1.0 | 14 | 546.0 | opposite-strand | FAD binding domain |
++ More..