Result : EXP01838
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01838 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 524687 |
| Right | 524812 |
| Strand | + |
| Nucleotide Sequence | GTGCCGTTCGGTGCCGAAGCGGCCACCGCCGAGCCGATGACGAGCAGTACGGCGTACGCGATCATCATGCGCCGCTGGGGAAGGTGCTGTGCGAACTGCACGGCCAGTACGGTCCCTACCGCGTAG |
| Sequence | VPFGAEAATAEPMTSSTAYAIIMRRWGRCCANCTASTVPTA |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 501208 | 501333 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 3615901 | 3616026 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 3 | 401670 | 401789 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 4 | 292411 | 292545 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00582.28 | 1.0 | 4 | -125.0 | opposite-strand | Universal stress protein family |
++ More..