Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01837 |
NCBI Accession ID | CP000480.1 |
Organism | Mycolicibacterium smegmatis MC2 155 |
Left | 5781120 |
Right | 5781245 |
Strand | + |
Nucleotide Sequence | GTGCTGATACTCGGCCTGGCCCAGACCATCGTGAGCTACCGCGGCGAATCCCTCATCCCCGGCTTCGGCGGCAACCGCCCCGTGCTGGCGGAGCGGGAGGGGACGATGGCGTGGGGGGCCCGGTGA |
Sequence | VLILGLAQTIVSYRGESLIPGFGGNRPVLAEREGTMAWGAR |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | 32181921 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5791538 | 5791663 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
2 | 2589797 | 2589922 | - | NZ_CP012150.1 | Mycobacterium goodii |
3 | 3241859 | 3242008 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
4 | 847413 | 847562 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
5 | 1199072 | 1199221 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
6 | 1157554 | 1157682 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
7 | 826148 | 826297 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
8 | 6228802 | 6228936 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
9 | 792733 | 792852 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
10 | 730556 | 730687 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
11 | 965676 | 965795 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
12 | 796996 | 797115 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
13 | 731436 | 731567 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
14 | 854485 | 854604 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
15 | 2366688 | 2366816 | - | NZ_AP022606.1 | Mycobacterium branderi |
16 | 6208594 | 6208728 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01047.24 | 0.88 | 14 | 3228.5 | opposite-strand | MarR family |
2 | PF12802.9 | 0.88 | 14 | 3228.5 | opposite-strand | MarR family |
3 | PF10745.11 | 0.94 | 15 | 2879 | same-strand | Protein of unknown function (DUF2530) |
4 | PF10604.11 | 0.69 | 11 | 2428 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
5 | PF11228.10 | 1.0 | 16 | 1604.5 | opposite-strand | Protein of unknown function (DUF3027) |
6 | PF10969.10 | 1.0 | 16 | -3.0 | same-strand | Protein of unknown function (DUF2771) |
7 | PF00313.24 | 0.94 | 15 | 1546 | opposite-strand | 'Cold-shock' DNA-binding domain |
8 | PF06463.15 | 0.62 | 10 | 2101.5 | same-strand | Molybdenum Cofactor Synthesis C |
9 | PF04055.23 | 0.62 | 10 | 2101.5 | same-strand | Radical SAM superfamily |