Result : EXP01837
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01837 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 5781120 |
| Right | 5781245 |
| Strand | + |
| Nucleotide Sequence | GTGCTGATACTCGGCCTGGCCCAGACCATCGTGAGCTACCGCGGCGAATCCCTCATCCCCGGCTTCGGCGGCAACCGCCCCGTGCTGGCGGAGCGGGAGGGGACGATGGCGTGGGGGGCCCGGTGA |
| Sequence | VLILGLAQTIVSYRGESLIPGFGGNRPVLAEREGTMAWGAR |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 32181921 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5791538 | 5791663 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 2589797 | 2589922 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 3 | 3241859 | 3242008 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 4 | 847413 | 847562 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 5 | 1199072 | 1199221 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 6 | 1157554 | 1157682 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 7 | 826148 | 826297 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 8 | 6228802 | 6228936 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 9 | 792733 | 792852 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 10 | 730556 | 730687 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 11 | 965676 | 965795 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 12 | 796996 | 797115 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 13 | 731436 | 731567 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 14 | 854485 | 854604 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 15 | 2366688 | 2366816 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 16 | 6208594 | 6208728 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01047.24 | 0.88 | 14 | 3228.5 | opposite-strand | MarR family |
| 2 | PF12802.9 | 0.88 | 14 | 3228.5 | opposite-strand | MarR family |
| 3 | PF10745.11 | 0.94 | 15 | 2879 | same-strand | Protein of unknown function (DUF2530) |
| 4 | PF10604.11 | 0.69 | 11 | 2428 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 5 | PF11228.10 | 1.0 | 16 | 1604.5 | opposite-strand | Protein of unknown function (DUF3027) |
| 6 | PF10969.10 | 1.0 | 16 | -3.0 | same-strand | Protein of unknown function (DUF2771) |
| 7 | PF00313.24 | 0.94 | 15 | 1546 | opposite-strand | 'Cold-shock' DNA-binding domain |
| 8 | PF06463.15 | 0.62 | 10 | 2101.5 | same-strand | Molybdenum Cofactor Synthesis C |
| 9 | PF04055.23 | 0.62 | 10 | 2101.5 | same-strand | Radical SAM superfamily |
++ More..