Result : B3CN01
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L21 |
| NCBI Accession ID | AM999887.1 |
| Organism | Wolbachia pipientis subsp. Culex pipiens (strain wPip) |
| Left | 1224917 |
| Right | 1225219 |
| Strand | + |
| Nucleotide Sequence | ATGTTTGCAGTAATCGAAACTGGTGGAAAGCAGTATTTAGTAAAAAAAGGCAGCATAATTAAAGTAGAAAGATTACAAGCTGAAGAAAAAGAGGAAGTGGAAATCAATAAAGTGATTTGTGTTTCAAACAATGGCTTATCTTGTTCATCTAATGCTGTTGTTAAAGCTGAAGTACTGGAGCAGTGTAGAGATAAAAAAATTATAATCTTTAAGAAAAAGAGAAGAAAAAATTACCGTAGGAAAAATGGTCATAGGCAGTATATTACTGTTCTTCGTATCAATGAAATTAGTCTTCAAAAGTAA |
| Sequence | MFAVIETGGKQYLVKKGSIIKVERLQAEEKEEVEINKVICVSNNGLSCSSNAVVKAEVLEQCRDKKIIIFKKKRRKNYRRKNGHRQYITVLRINEISLQK |
| Source of smORF | Swiss-Prot |
| Function | This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000255|HAMAP-Rule:MF_01363}. |
| Pubmed ID | 18550617 |
| Domain | CDD:412347 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B3CN01 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 51
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1896165 | 1896476 | - | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 2 | 4480734 | 4481036 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 3 | 391529 | 391828 | + | NZ_CP014525.1 | Haematospirillum jordaniae |
| 4 | 1993153 | 1993464 | - | NZ_CP030126.1 | Indioceanicola profundi |
| 5 | 4596312 | 4596623 | + | NZ_CP030265.1 | Skermanella pratensis |
| 6 | 3439088 | 3439399 | - | NZ_CP024199.1 | Thalassospira marina |
| 7 | 3668558 | 3668869 | - | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 8 | 1464820 | 1465122 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 9 | 1047482 | 1047793 | + | NZ_CP031555.1 | Thalassospira indica |
| 10 | 2262629 | 2262931 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 11 | 1092905 | 1093219 | + | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 12 | 540044 | 540352 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 13 | 1893085 | 1893402 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 14 | 1890661 | 1890975 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 15 | 752712 | 753026 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 16 | 639522 | 639830 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 17 | 546471 | 546785 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 18 | 4570209 | 4570520 | + | NZ_AP019700.1 | Stella humosa |
| 19 | 196051 | 196365 | + | NZ_CP068419.1 | Gluconobacter sphaericus |
| 20 | 2678211 | 2678522 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 21 | 1568508 | 1568822 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 22 | 1902504 | 1902818 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 23 | 809142 | 809456 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 24 | 818567 | 818875 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 25 | 2123099 | 2123413 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 26 | 547285 | 547593 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 27 | 2473830 | 2474147 | - | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 28 | 15628 | 15942 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
| 29 | 1552941 | 1553252 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 30 | 711106 | 711414 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 31 | 1901995 | 1902312 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 32 | 840255 | 840572 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 33 | 1582108 | 1582425 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 34 | 2140317 | 2140631 | - | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 35 | 1719156 | 1719470 | + | NZ_CP014689.1 | Gluconobacter albidus |
| 36 | 181823 | 182137 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 37 | 154704 | 155018 | + | NZ_CP038141.1 | Swingsia samuiensis |
| 38 | 293178 | 293477 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 39 | 687109 | 687420 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 40 | 662312 | 662611 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 41 | 800931 | 801230 | - | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 42 | 819800 | 820099 | - | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 43 | 803429 | 803728 | - | NZ_CP047224.1 | Neorickettsia findlayensis |
| 44 | 822462 | 822761 | - | NZ_CP007481.1 | Neorickettsia helminthoeca str. Oregon |
| 45 | 928508 | 928819 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 46 | 1277525 | 1277839 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 47 | 1503598 | 1503915 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 48 | 1866758 | 1867060 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 49 | 66896 | 67210 | - | NZ_CP012946.1 | Blastochloris viridis |
| 50 | 2889923 | 2890240 | + | NZ_CP053708.1 | Lichenicola cladoniae |
| 51 | 726919 | 727218 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007626.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01018.24 | 0.82 | 42 | 474.0 | same-strand | GTP1/OBG |
| 2 | PF01926.25 | 0.84 | 43 | 477 | same-strand | 50S ribosome-binding GTPase |
| 3 | PF02421.20 | 0.82 | 42 | 474.0 | same-strand | Ferrous iron transport protein B |
| 4 | PF01016.21 | 1.0 | 51 | 38 | same-strand | Ribosomal L27 protein |
| 5 | PF00696.30 | 0.69 | 35 | 1503.0 | same-strand | Amino acid kinase family |
| 6 | PF01472.22 | 0.65 | 33 | 1501 | same-strand | PUA domain |
++ More..