Result : B2V983
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) |
| NCBI Accession ID | CP001080.1 |
| Organism | Sulfurihydrogenibium sp. (strain YO3AOP1) |
| Left | 912555 |
| Right | 912857 |
| Strand | - |
| Nucleotide Sequence | ATGGTACCATTTGAATACTACGTAGCTTTAAGCGGACTTCTTATGGTTCTTGGTTTTATTGGTGTAATAATTAGGAAAAATATTATTGCGATGCTACTATCAACAGAGCTTATGCTAAACGCAGTAAATATAGCATTTGTTGCCTTTGATATGAAACTTCATGACGTGGTAGGTCAAGTATTTGTATTTTTTATCTTAACTATAGCAGCTGCGGAAGCGGCGATAGGTCTTGGCTTAATAATAGCAATCTACAGAATGAAAAAAGATGTTGATGTAGAAAAACTAACAGAGTTAAAGGGGTAG |
| Sequence | MVPFEYYVALSGLLMVLGFIGVIIRKNIIAMLLSTELMLNAVNIAFVAFDMKLHDVVGQVFVFFILTIAAAEAAIGLGLIIAIYRMKKDVDVEKLTELKG |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. {ECO:0000255|HAMAP-Rule:MF_01456}. |
| Pubmed ID | 19136599 |
| Domain | CDD:412408 |
| Functional Category | Others |
| Uniprot ID | B2V983 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 95
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 254980 | 255282 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 2 | 1333700 | 1334002 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 3 | 509122 | 509370 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 4 | 565986 | 566288 | + | NZ_CP010028.1 | Deinococcus radiopugnans |
| 5 | 1367453 | 1367755 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 6 | 712907 | 713209 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 7 | 2148768 | 2149070 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 8 | 2448353 | 2448655 | - | NZ_CP021081.1 | Deinococcus ficus |
| 9 | 601070 | 601372 | + | NC_012526.1 | Deinococcus deserti VCD115 |
| 10 | 2733607 | 2733909 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 11 | 1518251 | 1518499 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 12 | 981056 | 981358 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 13 | 1914974 | 1915276 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 14 | 1251926 | 1252228 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 15 | 2411309 | 2411560 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 16 | 2470608 | 2470913 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 17 | 1522366 | 1522617 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 18 | 5666112 | 5666363 | + | NZ_CP047650.1 | Xylophilus rhododendri |
| 19 | 1397115 | 1397366 | + | NC_008752.1 | Acidovorax citrulli AAC00-1 |
| 20 | 1434174 | 1434425 | + | NC_015138.1 | Acidovorax avenae subsp. avenae ATCC 19860 |
| 21 | 1758108 | 1758452 | + | NZ_CP020105.1 | Spirosoma rigui |
| 22 | 6487989 | 6488258 | + | NZ_CP065748.1 | Delftia lacustris |
| 23 | 6443417 | 6443686 | + | NZ_CP017420.1 | Delftia tsuruhatensis |
| 24 | 4647850 | 4648194 | - | NZ_CP014263.1 | Spirosoma montaniterrae |
| 25 | 6567639 | 6567983 | - | NZ_CP025096.1 | Spirosoma pollinicola |
| 26 | 7388901 | 7389158 | - | NZ_CP020104.1 | Spirosoma aerolatum |
| 27 | 13499 | 13843 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 28 | 246062 | 246406 | - | NZ_CP050063.1 | Spirosoma aureum |
| 29 | 1527751 | 1528008 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 30 | 5727891 | 5728235 | - | NZ_CP010429.1 | Spirosoma radiotolerans |
| 31 | 1920194 | 1920463 | - | NZ_CP060790.1 | Acidovorax monticola |
| 32 | 2009678 | 2009929 | - | NZ_CP019038.1 | Massilia putida |
| 33 | 172558 | 172887 | - | NZ_CP042436.1 | Mucilaginibacter ginsenosidivorans |
| 34 | 2140123 | 2140425 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 35 | 933233 | 933535 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 36 | 1549235 | 1549534 | - | NZ_LT828648.1 | Nitrospira japonica |
| 37 | 450755 | 451018 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 38 | 460289 | 460591 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 39 | 3532569 | 3532820 | - | NZ_CP013729.1 | Roseateles depolymerans |
| 40 | 57920 | 58225 | - | NZ_CP031124.1 | Ephemeroptericola cinctiostellae |
| 41 | 1247783 | 1248031 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 42 | 2275152 | 2275403 | - | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 43 | 957486 | 957737 | + | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 44 | 260506 | 260757 | + | NZ_CP025120.1 | Kangiella profundi |
| 45 | 1226125 | 1226427 | + | NZ_CP011387.1 | Deinococcus puniceus |
| 46 | 310883 | 311131 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 47 | 2265981 | 2266247 | - | NZ_CP040709.1 | Inhella inkyongensis |
| 48 | 1536468 | 1536773 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 49 | 703465 | 703716 | + | NZ_CP029556.1 | Lysobacter oculi |
| 50 | 97669 | 97974 | - | NZ_LR134433.1 | Legionella adelaidensis |
| 51 | 2272687 | 2272938 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 52 | 3457257 | 3457526 | - | NZ_CP011129.1 | Lysobacter antibioticus |
| 53 | 3466284 | 3466553 | - | NZ_CP023465.1 | Lysobacter capsici |
| 54 | 2922659 | 2922928 | - | NZ_CP035503.1 | Rhodoferax sediminis |
| 55 | 2409214 | 2409483 | + | NZ_CP011131.1 | Lysobacter gummosus |
| 56 | 1201750 | 1201998 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 57 | 2263447 | 2263713 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 58 | 1912784 | 1913089 | - | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 59 | 3846416 | 3846721 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 60 | 689237 | 689542 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 61 | 632430 | 632735 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
| 62 | 958028 | 958333 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 63 | 1340234 | 1340539 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 64 | 117163 | 117465 | + | NZ_CP015136.1 | Luteitalea pratensis |
| 65 | 1020852 | 1021118 | + | NZ_CP031188.1 | Flavobacterium arcticum |
| 66 | 1792983 | 1793252 | - | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 67 | 3465805 | 3466110 | - | NZ_LT906442.1 | Legionella waltersii |
| 68 | 2133122 | 2133403 | + | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 69 | 2181382 | 2181690 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 70 | 645976 | 646230 | + | NZ_CP042831.1 | Flavobacterium alkalisoli |
| 71 | 4034861 | 4035169 | - | NZ_CP044331.1 | Methylocystis parvus |
| 72 | 1470984 | 1471289 | + | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 73 | 1219437 | 1219715 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
| 74 | 170544 | 170828 | + | NZ_CP038017.1 | Allofrancisella frigidaquae |
| 75 | 3142140 | 3142445 | - | NZ_CP013742.1 | Legionella pneumophila |
| 76 | 918546 | 918851 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 77 | 4415075 | 4415377 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 78 | 4035740 | 4036045 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 79 | 2162106 | 2162378 | - | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 80 | 86330 | 86581 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 81 | 2742569 | 2742874 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 82 | 1352399 | 1352650 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 83 | 1849727 | 1850008 | + | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 84 | 1967648 | 1967929 | + | NC_023018.2 | Pandoraea pnomenusa |
| 85 | 2253904 | 2254182 | + | NZ_CP013481.2 | Pandoraea apista |
| 86 | 4184832 | 4185110 | - | NZ_CP047385.1 | Pandoraea fibrosis |
| 87 | 1971614 | 1971892 | + | NZ_CP011253.3 | Pandoraea oxalativorans |
| 88 | 2027104 | 2027382 | + | NZ_CP010897.2 | Pandoraea vervacti |
| 89 | 3418542 | 3418820 | - | NZ_LT906435.1 | Pandoraea sputorum |
| 90 | 2201315 | 2201593 | + | NZ_CP010310.2 | Pandoraea pulmonicola |
| 91 | 3781200 | 3781478 | - | NZ_CP013480.3 | Pandoraea norimbergensis |
| 92 | 941025 | 941333 | - | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 93 | 1975485 | 1975778 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 94 | 4801941 | 4802204 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 95 | 419607 | 419876 | - | NZ_CP060711.1 | Thermomonas brevis |
| 96 | 413396 | 413644 | + | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011801.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00361.22 | 1.0 | 95 | 2055 | same-strand | Proton-conducting membrane transporter |
| 2 | PF00662.22 | 0.99 | 94 | 11 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 3 | PF00499.22 | 0.92 | 87 | 38.0 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
| 4 | PF12838.9 | 0.91 | 86 | 704.5 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF13237.8 | 0.89 | 85 | 705 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF13187.8 | 0.89 | 85 | 704.5 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF00146.23 | 0.89 | 85 | 1233 | same-strand | NADH dehydrogenase |
| 8 | PF00037.29 | 0.86 | 82 | 705.5 | same-strand | 4Fe-4S binding domain |
| 9 | PF12800.9 | 0.6 | 57 | 733 | same-strand | 4Fe-4S binding domain |
| 10 | PF13510.8 | 0.82 | 78 | 2329.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 11 | PF10588.11 | 0.83 | 79 | 2329 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 12 | PF00111.29 | 0.76 | 72 | 2326.5 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 13 | PF01512.19 | 0.78 | 74 | 4599.0 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
| 14 | PF10589.11 | 0.78 | 74 | 4599.0 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
| 15 | PF10531.11 | 0.77 | 73 | 4604 | same-strand | SLBB domain |
++ More..