Result : B2V7T1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP001080.1 |
| Organism | Sulfurihydrogenibium sp. (strain YO3AOP1) |
| Left | 375670 |
| Right | 375969 |
| Strand | + |
| Nucleotide Sequence | ATGACAAATCAAATAGAAAAAGAGTTAATTGAAAAAGTAGCAAAATTATCAAACTTGAAATTAAAAGAAGAAGAGATAGAGTTATTTTCAAATCAGTTTAAAGATATTTTGAGTTTTATAGATAAGCTAAATGAGGTTGATGTAAAAGATACATTGCCATTTTATGAACTTCAAATTGAAGAAAAATCGGAAAGGGAAGATATTCCTACAGGCTCAATAACAAACGAAGAAGCAATAAAAAACGCACCACAAGCAAAAGGTGGATTTTTTGTTGTTCCAAGAGTTGTTGGCGAAGAATAA |
| Sequence | MTNQIEKELIEKVAKLSNLKLKEEEIELFSNQFKDILSFIDKLNEVDVKDTLPFYELQIEEKSEREDIPTGSITNEEAIKNAPQAKGGFFVVPRVVGEE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 19136599 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | B2V7T1 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 142265 | 142507 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 2 | 1881866 | 1882156 | - | NC_012440.1 | Persephonella marina EX-H1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012438.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03462.20 | 1.0 | 2 | 3496.5 | same-strand | PCRF domain |
| 2 | PF00472.22 | 1.0 | 2 | 3496.5 | same-strand | RF-1 domain |
| 3 | PF06508.15 | 1.0 | 2 | 2209.5 | same-strand | Queuosine biosynthesis protein QueC |
| 4 | PF01131.22 | 1.0 | 2 | 172.0 | same-strand | DNA topoisomerase |
| 5 | PF01751.24 | 1.0 | 2 | 172.0 | same-strand | Toprim domain |
| 6 | PF00154.23 | 1.0 | 2 | 20.0 | same-strand | recA bacterial DNA recombination protein |
| 7 | PF08423.13 | 1.0 | 2 | 20.0 | same-strand | Rad51 |
| 8 | PF00437.22 | 1.0 | 2 | 1043.5 | same-strand | Type II/IV secretion system protein |
| 9 | PF02631.18 | 1.0 | 2 | 2155.0 | same-strand | RecX family |
| 10 | PF06574.14 | 1.0 | 2 | 2571.0 | same-strand | FAD synthetase |
| 11 | PF01687.19 | 1.0 | 2 | 2571.0 | same-strand | Riboflavin kinase |
| 12 | PF01467.28 | 1.0 | 2 | 2571.0 | same-strand | Cytidylyltransferase-like |
| 13 | PF13174.8 | 1.0 | 2 | 3489.0 | same-strand | Tetratricopeptide repeat |
| 14 | PF13181.8 | 1.0 | 2 | 3489.0 | same-strand | Tetratricopeptide repeat |
++ More..