Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01769 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli K12 |
Left | 1848681 |
Right | 1848779 |
Strand | - |
Nucleotide Sequence | ATGACCCAACCGGTACTTGTCAGCAGGAATTGCGGACTGTGCTGTAACAAAATCCACTCTCGTGTTAATTTTGTGAATAAATATCACGACAGGAGTTAA |
Sequence | MTQPVLVSRNCGLCCNKIHSRVNFVNKYHDRS |
Source of smORF | Literature |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 32 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1848681 | 1848779 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1493974 | 1494072 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 2224451 | 2224549 | - | NZ_CP061527.1 | Shigella dysenteriae |
4 | 2448330 | 2448428 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
5 | 1986236 | 1986334 | + | NZ_LR134340.1 | Escherichia marmotae |
6 | 1779339 | 1779437 | - | NZ_AP014857.1 | Escherichia albertii |
7 | 4338770 | 4338868 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
8 | 4773218 | 4773316 | + | NZ_CP033744.1 | Citrobacter freundii |
9 | 297233 | 297331 | - | NZ_CP044098.1 | Citrobacter portucalensis |
10 | 627798 | 627896 | + | NZ_CP038469.1 | Citrobacter tructae |
11 | 1086224 | 1086322 | + | NZ_CP017279.1 | Enterobacter ludwigii |
12 | 3789368 | 3789466 | + | NZ_CP053416.1 | Salmonella bongori |
13 | 739112 | 739210 | + | NZ_CP023529.1 | Lelliottia amnigena |
14 | 2099146 | 2099244 | + | NZ_CP043318.1 | Enterobacter chengduensis |
15 | 1866180 | 1866278 | + | NZ_CP009756.1 | Enterobacter cloacae |
16 | 676431 | 676529 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
17 | 1817964 | 1818062 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
18 | 1882766 | 1882864 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
19 | 1848545 | 1848643 | + | NZ_AP022508.1 | Enterobacter bugandensis |
20 | 1623207 | 1623305 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
21 | 1374828 | 1374926 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
22 | 1842647 | 1842745 | + | NC_015968.1 | Enterobacter soli |
23 | 3476086 | 3476184 | - | NZ_CP045205.1 | Citrobacter telavivensis |
24 | 3527474 | 3527572 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
25 | 287101 | 287199 | + | NZ_CP057657.1 | Escherichia fergusonii |
26 | 2019234 | 2019332 | + | NZ_CP015113.1 | Kosakonia radicincitans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00208.23 | 0.84 | 21 | 3726.5 | opposite-strand | Glutamate/Leucine/Phenylalanine/Valine dehydrogenase |
2 | PF02812.20 | 0.84 | 21 | 3726.5 | opposite-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
3 | PF01131.22 | 0.96 | 24 | 1720 | same-strand | DNA topoisomerase |
4 | PF01751.24 | 0.96 | 24 | 1720 | same-strand | Toprim domain |
5 | PF02769.24 | 0.96 | 24 | 673 | same-strand | AIR synthase related protein, C-terminal domain |
6 | PF00586.26 | 0.96 | 24 | 673 | same-strand | AIR synthase related protein, N-terminal domain |
7 | PF00881.26 | 1.0 | 25 | 5.0 | same-strand | Nitroreductase family |
8 | PF01343.20 | 1.0 | 25 | 66.0 | opposite-strand | Peptidase family S49 |
9 | PF00710.22 | 0.96 | 24 | 1986 | opposite-strand | Asparaginase, N-terminal |
10 | PF17763.3 | 1.0 | 25 | 1986.0 | opposite-strand | Glutaminase/Asparaginase C-terminal domain |
11 | PF00857.22 | 1.0 | 25 | 3012.0 | opposite-strand | Isochorismatase family |
12 | PF07023.14 | 0.64 | 16 | 5140.5 | same-strand | Protein of unknown function (DUF1315) |
13 | PF07383.14 | 0.72 | 18 | 5295.5 | same-strand | Protein of unknown function (DUF1496) |