Result : EXP01768
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01768 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 198987 |
| Right | 199133 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTACCTGATAGAAGAGTGAGTAAGACAAGAGCGGCAAAAAGACGCACGCATTATAGCGTTAAGTTGGCTAAACCTGTGAAAGCCAAAGATGGCACTTGGAAGCTCCCCCATCATATTAACAAATTTACTAAAGAATACTAA |
| Sequence | MAVPDRRVSKTRAAKRRTHYSVKLAKPVKAKDGTWKLPHHINKFTKEY |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];large ribosomal subunit [GO:0015934];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:415589 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | A6QBY2 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 87
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 195425 | 195571 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 330459 | 330605 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 54507 | 54656 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 1536910 | 1537062 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 5 | 658674 | 658823 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 6 | 295816 | 295965 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 7 | 1656818 | 1656967 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 8 | 1881395 | 1881544 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 9 | 848277 | 848429 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 10 | 1097301 | 1097453 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 11 | 1891941 | 1892093 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 12 | 1621050 | 1621205 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 13 | 1179168 | 1179320 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 14 | 69546 | 69692 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 15 | 1857378 | 1857527 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 16 | 2511330 | 2511482 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 17 | 227210 | 227362 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 18 | 242239 | 242397 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 19 | 2598431 | 2598583 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 20 | 681194 | 681340 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 21 | 1896831 | 1896977 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 22 | 212328 | 212480 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 23 | 1076459 | 1076605 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 24 | 496163 | 496312 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 25 | 1891761 | 1891916 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 26 | 401250 | 401396 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 27 | 224674 | 224820 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 28 | 291720 | 291872 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 29 | 270341 | 270493 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 30 | 241503 | 241649 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 31 | 1498477 | 1498623 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 32 | 210715 | 210861 | + | NZ_CP059443.1 | Campylobacter fetus |
| 33 | 1247949 | 1248095 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 34 | 1491361 | 1491507 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 35 | 332855 | 333004 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 36 | 1578350 | 1578496 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 37 | 1403168 | 1403314 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 38 | 1283142 | 1283288 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 39 | 1286147 | 1286293 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 40 | 285275 | 285421 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 41 | 174366 | 174512 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 42 | 577984 | 578130 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 43 | 1354045 | 1354191 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 44 | 2178294 | 2178440 | + | NZ_CP012543.1 | Campylobacter rectus |
| 45 | 298317 | 298463 | - | NZ_CP012544.1 | Campylobacter showae |
| 46 | 1342498 | 1342644 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 47 | 1560234 | 1560380 | + | NZ_CP053826.1 | Campylobacter curvus |
| 48 | 1524414 | 1524560 | + | NZ_CP012541.1 | Campylobacter concisus |
| 49 | 391159 | 391320 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 50 | 388380 | 388541 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 51 | 293886 | 294038 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 52 | 1446470 | 1446616 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 53 | 300842 | 300988 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 54 | 441478 | 441630 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 55 | 406576 | 406728 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 56 | 354172 | 354324 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 57 | 265282 | 265434 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 58 | 2409807 | 2409959 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 59 | 2425803 | 2425955 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 60 | 2184624 | 2184773 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 61 | 1405776 | 1405922 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 62 | 2506212 | 2506364 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 63 | 2441439 | 2441591 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 64 | 2247767 | 2247919 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 65 | 395024 | 395176 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 66 | 403479 | 403631 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 67 | 274936 | 275088 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 68 | 1656029 | 1656181 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 69 | 2500744 | 2500896 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 70 | 2678493 | 2678645 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 71 | 333806 | 333958 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 72 | 392930 | 393082 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 73 | 2433978 | 2434130 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 74 | 2770714 | 2770866 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 75 | 1957427 | 1957579 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 76 | 1934405 | 1934557 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 77 | 1737069 | 1737221 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 78 | 314204 | 314356 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 79 | 1663731 | 1663883 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 80 | 374293 | 374442 | - | NC_012115.1 | Nautilia profundicola AmH |
| 81 | 1519180 | 1519329 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 82 | 384396 | 384545 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 83 | 1241518 | 1241664 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 84 | 1957012 | 1957158 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 85 | 1244157 | 1244297 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 86 | 1444564 | 1444710 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 87 | 2434069 | 2434242 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022826.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00334.21 | 0.93 | 81 | 393 | same-strand | Nucleoside diphosphate kinase |
| 2 | PF02504.17 | 0.93 | 81 | 4 | same-strand | Fatty acid synthesis protein |
| 3 | PF08541.12 | 0.94 | 82 | 1008.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 4 | PF08545.12 | 0.94 | 82 | 1008.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
| 5 | PF12838.9 | 0.79 | 69 | 929 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF00037.29 | 0.79 | 69 | 929 | same-strand | 4Fe-4S binding domain |
| 7 | PF13187.8 | 0.79 | 69 | 929 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF13237.8 | 0.79 | 69 | 929 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF00578.23 | 0.62 | 54 | 1466.0 | opposite-strand | AhpC/TSA family |
| 10 | PF10417.11 | 0.62 | 54 | 1466.0 | opposite-strand | C-terminal domain of 1-Cys peroxiredoxin |
++ More..