Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01763 |
NCBI Accession ID | BA000022.2 |
Organism | Synechocystis sp. PCC 6803 |
Left | 133917 |
Right | 134177 |
Strand | + |
Nucleotide Sequence | TTGACCATGGCCCCTGGATACCGTCGTTGCCTCAGCTGTCGCAAAGTAGGCGATCGCCGACAATTTTGGCGAATTGTCCGAGTCTATCCATCTCGAACTGTACAATTAGATCACGGTGCGGGGCGATCGGCTTATTTATGTCCGACCCATGACTGTCTGCGTAAAGCTCGCCACAAAAATCTGTTGGGGCGGGCCCTCCGAGCCCCAGTTCCCAGCCATCTCTTTGAGCAACTAGAAGCCCGTCTTCTCACCACTCCCTGA |
Sequence | LTMAPGYRRCLSCRKVGDRRQFWRIVRVYPSRTVQLDHGAGRSAYLCPTHDCLRKARHKNLLGRALRAPVPSHLFEQLEARLLTTP |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl00189. Profile Description: N/A. Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation |
Pubmed ID | 30796087 |
Domain | CDD:412207 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 794988 | 795233 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
2 | 2630733 | 2630987 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
3 | 7139410 | 7139679 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
4 | 4428998 | 4429273 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
5 | 4767412 | 4767681 | - | NZ_CP031941.1 | Nostoc sphaeroides |
6 | 2531533 | 2531802 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
7 | 1757606 | 1757857 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
8 | 1166993 | 1167262 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
9 | 5845384 | 5845659 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
10 | 3388177 | 3388446 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
11 | 4173867 | 4174130 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
12 | 3598756 | 3599025 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
13 | 238039 | 238323 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
14 | 2856630 | 2856911 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
15 | 7311268 | 7311543 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
16 | 76426 | 76695 | + | NC_009931.1 | Acaryochloris marina MBIC11017 |
17 | 50922 | 51203 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
18 | 4154347 | 4154595 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
19 | 626498 | 626770 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
20 | 3243243 | 3243515 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
21 | 1902563 | 1902826 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
22 | 2026032 | 2026295 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
23 | 1278201 | 1278482 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
24 | 3690754 | 3691014 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
25 | 1158342 | 1158605 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
26 | 5778860 | 5779078 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02576.19 | 0.84 | 21 | 1585 | same-strand | RimP N-terminal domain |
2 | PF17384.4 | 0.76 | 19 | 1585 | same-strand | RimP C-terminal SH3 domain |
3 | PF08529.13 | 0.84 | 21 | 92 | same-strand | NusA N-terminal domain |
4 | PF13184.8 | 0.84 | 21 | 92 | same-strand | NusA-like KH domain |
5 | PF11987.10 | 0.88 | 22 | 478.5 | same-strand | Translation-initiation factor 2 |
6 | PF00009.29 | 0.88 | 22 | 478.5 | same-strand | Elongation factor Tu GTP binding domain |
7 | PF04760.17 | 0.92 | 23 | 479 | same-strand | Translation initiation factor IF-2, N-terminal region |
8 | PF01926.25 | 0.88 | 22 | 478.5 | same-strand | 50S ribosome-binding GTPase |
9 | PF00071.24 | 0.76 | 19 | 482 | same-strand | Ras family |