Result : EXP01758
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01758 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 1053868 |
| Right | 1054020 |
| Strand | - |
| Nucleotide Sequence | TTGAGGGTTAATTATGATCGCCTGTTACAAAACGCTTCGCCTTTATTAGAACTCTCTCAAAACACCACTTTTAAAATCTATCGCAAAGCCTATCAAAAATCCTTACCTTTGTTGCGCGCTGTAAGGAGATGGGTTAAAAAAATGGGTTTGTAA |
| Sequence | LRVNYDRLLQNASPLLELSQNTTFKIYRKAYQKSLPLLRAVRRWVKKMGL |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 651436 | 651600 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1122910 | 1123074 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 3 | 424990 | 425133 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 4 | 920536 | 920679 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 5 | 1436455 | 1436595 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008229.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00483.25 | 1.0 | 3 | 3795 | opposite-strand | Nucleotidyl transferase |
| 2 | PF00275.22 | 1.0 | 3 | 2106 | opposite-strand | EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) |
| 3 | PF00206.22 | 1.0 | 3 | 644 | opposite-strand | Lyase |
| 4 | PF10415.11 | 1.0 | 3 | 644 | opposite-strand | Fumarase C C-terminus |
| 5 | PF03167.21 | 1.0 | 3 | 9 | opposite-strand | Uracil DNA glycosylase superfamily |
| 6 | PF00702.28 | 1.0 | 3 | 1312.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 7 | PF12710.9 | 1.0 | 3 | 1312.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 8 | PF13419.8 | 1.0 | 3 | 1312.0 | same-strand | Haloacid dehalogenase-like hydrolase |
| 9 | PF00210.26 | 1.0 | 3 | 1950.5 | same-strand | Ferritin-like domain |
| 10 | PF17827.3 | 0.67 | 2 | 2221.5 | opposite-strand | PrmC N-terminal domain |
| 11 | PF00208.23 | 0.67 | 2 | 762.0 | opposite-strand | Glutamate/Leucine/Phenylalanine/Valine dehydrogenase |
| 12 | PF02812.20 | 0.67 | 2 | 762.0 | opposite-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
| 13 | PF01578.22 | 0.67 | 2 | 2290.5 | same-strand | Cytochrome C assembly protein |
| 14 | PF01676.20 | 0.67 | 2 | 3085.5 | same-strand | Metalloenzyme superfamily |
| 15 | PF06415.15 | 0.67 | 2 | 3085.5 | same-strand | BPG-independent PGAM N-terminus (iPGM N) |
| 16 | PF02686.17 | 0.67 | 2 | 2790.5 | same-strand | Glu-tRNAGln amidotransferase C subunit |
++ More..