Result : B2V7L1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP001080.1 |
| Organism | Sulfurihydrogenibium sp. (strain YO3AOP1) |
| Left | 294015 |
| Right | 294308 |
| Strand | - |
| Nucleotide Sequence | ATGAAAACCATCTATGACATTATAATTAGACCTGTTCTTACAGAAAAAGCTGTAAAAGACAATGAAAAAAAGAACACTTTAACTTTTGAAGTTGACATGAACGCAAGTAAAACAGAAATCAAAGAAGCGGTAGAAAAGATTTTTAACGTAAAAGTTAAAGAAGTAAGAACTCTGATAGTTAAACCAAAGCCAAAAAGATTTGGCTTTAGGTCCTCTGGATACAAGAAAGCATGGAAAAAAGCTATTGTAAAAGTAGAGTCTGAAAAACCAATCAATATAGCTGAATTAGTATGA |
| Sequence | MKTIYDIIIRPVLTEKAVKDNEKKNTLTFEVDMNASKTEIKEAVEKIFNVKVKEVRTLIVKPKPKRFGFRSSGYKKAWKKAIVKVESEKPINIAELV |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 19136599 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B2V7L1 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 153
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1621194 | 1621487 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 2 | 1142955 | 1143215 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 3 | 1555722 | 1556003 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 4 | 5056 | 5301 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 5 | 1483248 | 1483541 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 6 | 392960 | 393241 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 7 | 1081884 | 1082165 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 8 | 1222271 | 1222516 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 9 | 1448892 | 1449140 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 10 | 828432 | 828728 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 11 | 2104552 | 2104842 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 12 | 1491052 | 1491300 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 13 | 173125 | 173394 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 14 | 126368 | 126652 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 15 | 3634291 | 3634584 | - | NZ_CP033433.1 | Cohnella candidum |
| 16 | 244572 | 244895 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 17 | 3983708 | 3984001 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 18 | 471240 | 471536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 19 | 288223 | 288513 | - | NZ_CP026363.1 | Brevibacillus agri |
| 20 | 4845101 | 4845391 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 21 | 268473 | 268763 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 22 | 3622926 | 3623216 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 23 | 3758050 | 3758340 | - | NC_014624.2 | Eubacterium callanderi |
| 24 | 2165340 | 2165630 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 25 | 1377836 | 1378126 | + | NZ_CP019962.1 | Eubacterium limosum |
| 26 | 241292 | 241579 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 27 | 1550805 | 1551092 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 28 | 272253 | 272489 | + | NC_022549.1 | Acholeplasma brassicae |
| 29 | 728698 | 728937 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 30 | 874574 | 874873 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 31 | 809737 | 810009 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 32 | 1156579 | 1156875 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 33 | 2022490 | 2022792 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 34 | 5135661 | 5135954 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 35 | 919789 | 920085 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 36 | 4578942 | 4579232 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 37 | 1176108 | 1176404 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 38 | 129110 | 129400 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 39 | 1635648 | 1635938 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 40 | 1403454 | 1403693 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 41 | 3679500 | 3679784 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 42 | 661762 | 662052 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 43 | 4690671 | 4690964 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 44 | 5297740 | 5298033 | - | NZ_CP009288.1 | Paenibacillus durus |
| 45 | 3077390 | 3077641 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 46 | 163744 | 164034 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 47 | 990059 | 990364 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 48 | 2951911 | 2952201 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 49 | 1535465 | 1535755 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 50 | 6316268 | 6316558 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 51 | 1711722 | 1712009 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
| 52 | 1693289 | 1693543 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 53 | 784320 | 784610 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 54 | 3722124 | 3722414 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 55 | 1869906 | 1870142 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 56 | 1810892 | 1811185 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 57 | 246503 | 246799 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 58 | 2377577 | 2377864 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 59 | 625047 | 625283 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 60 | 311702 | 311995 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 61 | 1136707 | 1136994 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 62 | 699011 | 699307 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 63 | 5702114 | 5702404 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 64 | 6392131 | 6392421 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 65 | 2607188 | 2607478 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 66 | 6157632 | 6157925 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 67 | 5020287 | 5020580 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 68 | 1237131 | 1237436 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 69 | 681883 | 682164 | + | NZ_CP009302.1 | Berryella intestinalis |
| 70 | 142601 | 142891 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 71 | 4388004 | 4388297 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 72 | 2124065 | 2124310 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 73 | 1207488 | 1207775 | + | NZ_CP061799.1 | Desulfonema limicola |
| 74 | 1212980 | 1213243 | - | NC_018001.1 | Desulfurococcus amylolyticus DSM 16532 |
| 75 | 2788082 | 2788372 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 76 | 2948416 | 2948679 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 77 | 2490633 | 2490887 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 78 | 4369137 | 4369427 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 79 | 1229676 | 1229915 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 80 | 7136848 | 7137141 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 81 | 2132821 | 2133072 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 82 | 3720393 | 3720683 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 83 | 1628259 | 1628549 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 84 | 1419573 | 1419818 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 85 | 610623 | 610862 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 86 | 603786 | 604025 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 87 | 6282624 | 6282917 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 88 | 1129255 | 1129548 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 89 | 6435925 | 6436218 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 90 | 1151580 | 1151873 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 91 | 129284 | 129574 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 92 | 974998 | 975234 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 93 | 1015906 | 1016193 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 94 | 4290078 | 4290347 | - | NZ_CP010803.1 | Martelella endophytica |
| 95 | 2079049 | 2079306 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 96 | 140219 | 140512 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 97 | 1554249 | 1554485 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 98 | 170401 | 170691 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 99 | 7400798 | 7401091 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 100 | 1668113 | 1668382 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 101 | 1223454 | 1223729 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 102 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 103 | 138245 | 138535 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 104 | 3318211 | 3318501 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 105 | 1216012 | 1216248 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 106 | 1038905 | 1039141 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 107 | 1813024 | 1813260 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 108 | 1146269 | 1146505 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 109 | 1003689 | 1003925 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 110 | 1819299 | 1819535 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 111 | 2403800 | 2404036 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 112 | 1801562 | 1801813 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 113 | 148342 | 148632 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 114 | 2071902 | 2072138 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 115 | 1942417 | 1942653 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 116 | 2013261 | 2013497 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 117 | 1709173 | 1709457 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 118 | 35587 | 35877 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 119 | 410745 | 410981 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 120 | 2355811 | 2356083 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 121 | 198106 | 198393 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 122 | 2979380 | 2979634 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 123 | 482113 | 482400 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 124 | 348791 | 349078 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 125 | 158568 | 158837 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 126 | 938223 | 938516 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 127 | 322922 | 323215 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 128 | 2292914 | 2293150 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 129 | 514688 | 514975 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 130 | 1674261 | 1674548 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 131 | 566320 | 566607 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 132 | 427007 | 427294 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 133 | 416040 | 416276 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 134 | 1962648 | 1962884 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 135 | 2174185 | 2174427 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 136 | 145411 | 145698 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 137 | 101779 | 102018 | + | NZ_CP017326.1 | Weissella soli |
| 138 | 1279694 | 1279969 | + | NZ_CP027770.1 | Staphylococcus felis |
| 139 | 3099158 | 3099445 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 140 | 2379832 | 2380083 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 141 | 129309 | 129596 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 142 | 2822961 | 2823248 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 143 | 143739 | 144026 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 144 | 2266765 | 2267052 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 145 | 1129090 | 1129377 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 146 | 1454127 | 1454414 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 147 | 1980149 | 1980424 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 148 | 651627 | 651902 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 149 | 692461 | 692754 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 150 | 1966124 | 1966363 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 151 | 59478 | 59765 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 152 | 313012 | 313266 | + | NC_017954.1 | Thermogladius calderae 1633 |
| 153 | 641221 | 641523 | + | NZ_LS483423.1 | Jonesia denitrificans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012438.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 0.95 | 145 | 2259 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 0.95 | 146 | 1580.5 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 0.95 | 146 | 1580.5 | same-strand | KH domain |
| 4 | PF00237.21 | 0.97 | 149 | 1214 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 0.99 | 152 | 908.0 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 0.99 | 152 | 28.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 0.99 | 152 | 28.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 1.0 | 153 | 0 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 0.99 | 151 | 1343 | same-strand | Ribosomal protein S10p/S20e |
| 10 | PF00009.29 | 0.69 | 105 | 2566.5 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF03143.19 | 0.63 | 97 | 1907 | same-strand | Elongation factor Tu C-terminal domain |
| 12 | PF03144.27 | 0.69 | 105 | 2566.5 | same-strand | Elongation factor Tu domain 2 |
| 13 | PF01926.25 | 0.64 | 98 | 1975 | same-strand | 50S ribosome-binding GTPase |
++ More..