Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01749 |
NCBI Accession ID | NC_017548.1 |
Organism | Pseudomonas aeruginosa M18 |
Left | 733758 |
Right | 734057 |
Strand | + |
Nucleotide Sequence | GTGCTATGGCTCCACCAATCCGGTGAACGTGGTTTATGCCACCTTCAAGGGCCTGAAGAACATGCAGGCTCCGGAAGCAGTAGCGGCCAAGCGTGGCAAGAGCGTCGAGGAGATTCTCTAACCATGGCAACTGTCAAAGTCACTCTGGTCAAGAGCCTGAACGGCCGTCTGGCCAACCACAAGGCTTGCGTCAAGGGTCTCGGCCTGCGTCGCATCAATCATACCGTCGAAGTTCAGGACACTCCTGAGAACCGCGGCATGATCAACAAGGCCTACTACCTGCTGCGTGTGGAGGGTTAA |
Sequence | VLWLHQSGERGLCHLQGPEEHAGSGSSSGQAWQERRGDSLTMATVKVTLVKSLNGRLANHKACVKGLGLRRINHTVEVQDTPENRGMINKAYYLLRVEG |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
Pubmed ID | 30796087 |
Domain | CDD:412218 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4758891 | 4759190 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
2 | 3423588 | 3423887 | + | NZ_CP045302.1 | Azotobacter salinestris |
3 | 1046297 | 1046599 | + | NZ_CP060009.1 | Pseudomonas sediminis |
4 | 746135 | 746437 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
5 | 615274 | 615573 | + | NC_012560.1 | Azotobacter vinelandii DJ |
6 | 4569764 | 4570066 | - | NZ_CP068551.1 | Pseudomonas khazarica |
7 | 3952693 | 3952992 | - | NZ_CP011835.1 | Azotobacter chroococcum |
8 | 1465187 | 1465489 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
9 | 2541343 | 2541657 | + | NZ_CP021358.1 | Kushneria marisflavi |
10 | 136240 | 136551 | + | NZ_CP014226.1 | Halomonas chromatireducens |
11 | 3635549 | 3635860 | - | NZ_CP021435.1 | Halomonas beimenensis |
12 | 3928124 | 3928435 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
13 | 516004 | 516315 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
14 | 292735 | 293046 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
15 | 1971304 | 1971615 | + | NZ_CP018139.1 | Halomonas aestuarii |
16 | 3084859 | 3085164 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00411.21 | 1.0 | 16 | 2432.5 | same-strand | Ribosomal protein S11 |
2 | PF00416.24 | 0.69 | 11 | 2046 | same-strand | Ribosomal protein S13/S18 |
3 | PF00444.20 | 0.75 | 12 | 1796.0 | same-strand | Ribosomal protein L36 |
4 | PF00344.22 | 1.0 | 16 | 439.0 | same-strand | SecY |
5 | PF00828.21 | 1.0 | 16 | 4.0 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
6 | PF03719.17 | 1.0 | 16 | -121.5 | same-strand | Ribosomal protein S5, C-terminal domain |
7 | PF00333.22 | 1.0 | 16 | -121.5 | same-strand | Ribosomal protein S5, N-terminal domain |
8 | PF00861.24 | 1.0 | 16 | 386.5 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
9 | PF00347.25 | 1.0 | 16 | 747.5 | same-strand | Ribosomal protein L6 |
10 | PF00410.21 | 1.0 | 16 | 1291.0 | same-strand | Ribosomal protein S8 |
11 | PF00253.23 | 1.0 | 16 | 1794.0 | same-strand | Ribosomal protein S14p/S29e |