Result : EXP01746
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01746 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 572599 |
| Right | 572742 |
| Strand | + |
| Nucleotide Sequence | GTGAGAAAAATACCTTTAAATTGTGAAGCTTGTGGCAATAGAAATTATAATGTTCCTAAGCAAGAAGGCTCGGCAACAAGATTAACCTTAAAGAAATATTGTCCAAAATGTAACGCGCACACAATTCATAAAGAATCGAAATAA |
| Sequence | VRKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];ribosome [GO:0005840];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00383. Profile Description: Ribosomal protein L33. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:412348 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0C0A7 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 215
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 517534 | 517677 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 537472 | 537615 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2404390 | 2404533 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 4 | 2342213 | 2342356 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 2274524 | 2274667 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 6 | 1217749 | 1217892 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 7 | 1113725 | 1113868 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 8 | 1730080 | 1730223 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 9 | 2194376 | 2194519 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 10 | 542036 | 542179 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 11 | 2267143 | 2267286 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 12 | 2267739 | 2267882 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 13 | 332230 | 332373 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 14 | 236083 | 236226 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 15 | 372402 | 372545 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 16 | 1567306 | 1567449 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 17 | 688560 | 688703 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 18 | 2394535 | 2394678 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 19 | 2676079 | 2676222 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 20 | 6857 | 7000 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 21 | 2446917 | 2447060 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 22 | 2023583 | 2023726 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 23 | 1545267 | 1545410 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 24 | 242246 | 242389 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 25 | 2252125 | 2252268 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 26 | 246376 | 246519 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 27 | 398507 | 398650 | - | NZ_CP027770.1 | Staphylococcus felis |
| 28 | 214827 | 214970 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 29 | 2277901 | 2278041 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 30 | 175550 | 175681 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 31 | 2400573 | 2400713 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 32 | 101702 | 101848 | + | NZ_CP016540.2 | Planococcus versutus |
| 33 | 2326267 | 2326407 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 34 | 111437 | 111565 | + | NZ_CP016538.2 | Planococcus maritimus |
| 35 | 111293 | 111421 | + | NZ_CP059540.1 | Planococcus maritimus |
| 36 | 110824 | 110952 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 37 | 2955628 | 2955759 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 38 | 3299605 | 3299733 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 39 | 113713 | 113859 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 40 | 4525139 | 4525270 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 41 | 219460 | 219591 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 42 | 1648882 | 1649028 | - | NZ_CP013661.2 | Planococcus kocurii |
| 43 | 113849 | 113995 | + | NZ_CP019401.1 | Planococcus faecalis |
| 44 | 133851 | 133997 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 45 | 926771 | 926920 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 46 | 5010255 | 5010401 | - | NZ_CP040336.1 | Bacillus luti |
| 47 | 103778 | 103924 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 48 | 109139 | 109285 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 49 | 29808 | 29954 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 50 | 109230 | 109376 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 51 | 110107 | 110238 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 52 | 109421 | 109567 | + | NC_011725.1 | Bacillus cereus B4264 |
| 53 | 410661 | 410810 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 54 | 120903 | 121049 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 55 | 228677 | 228814 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 56 | 460964 | 461101 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 57 | 471072 | 471209 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 58 | 1266640 | 1266789 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 59 | 1238927 | 1239076 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 60 | 11361 | 11495 | - | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 61 | 6773363 | 6773518 | - | NZ_CP036276.1 | Symmachiella dynata |
| 62 | 3813086 | 3813235 | - | NZ_CP011937.1 | Bacillus velezensis |
| 63 | 118307 | 118456 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 64 | 117054 | 117203 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 65 | 117175 | 117324 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 66 | 87066 | 87215 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 67 | 1892214 | 1892363 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 68 | 117349 | 117498 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 69 | 311816 | 311965 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 70 | 586730 | 586888 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 71 | 232349 | 232492 | + | NZ_CP053989.1 | Niallia circulans |
| 72 | 214281 | 214424 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 73 | 253342 | 253491 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 74 | 2549050 | 2549202 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 75 | 392647 | 392793 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 76 | 2458276 | 2458425 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 77 | 791881 | 792030 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 78 | 117289 | 117438 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 79 | 2595975 | 2596124 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 80 | 54027 | 54176 | + | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
| 81 | 55343 | 55492 | + | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 82 | 107879 | 108025 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 83 | 831790 | 831918 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 84 | 124757 | 124906 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 85 | 163542 | 163694 | - | NC_014962.1 | Isosphaera pallida ATCC 43644 |
| 86 | 542268 | 542420 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 87 | 18898 | 19044 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 88 | 2716910 | 2717041 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 89 | 923269 | 923421 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 90 | 803253 | 803381 | - | NZ_CP059674.1 | Mycoplasma tullyi |
| 91 | 853519 | 853647 | - | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 92 | 2555542 | 2555691 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 93 | 2470091 | 2470255 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 94 | 58028 | 58174 | - | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 95 | 1515747 | 1515896 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 96 | 900826 | 900975 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 97 | 116307 | 116456 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 98 | 120387 | 120530 | + | NZ_CP012024.1 | Bacillus smithii |
| 99 | 753580 | 753696 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 100 | 3118516 | 3118647 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 101 | 879304 | 879462 | - | NZ_CP025257.1 | Mesoplasma syrphidae |
| 102 | 1785242 | 1785388 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 103 | 7645173 | 7645325 | - | NZ_CP017641.1 | Fuerstia marisgermanicae |
| 104 | 131369 | 131530 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 105 | 7088677 | 7088832 | - | NZ_CP036353.1 | Gimesia maris |
| 106 | 166577 | 166735 | - | NZ_CP024963.1 | Entomoplasma luminosum |
| 107 | 1265893 | 1266045 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 108 | 35923 | 36081 | + | NZ_CP043026.1 | Spiroplasma chinense |
| 109 | 866133 | 866270 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 110 | 3485383 | 3485535 | + | NZ_CP019082.1 | Paludisphaera borealis |
| 111 | 2089038 | 2089187 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 112 | 40783 | 40911 | + | NZ_LR215023.1 | Mycoplasma iowae |
| 113 | 4297784 | 4297939 | + | NZ_CP043930.1 | Gimesia benthica |
| 114 | 1647852 | 1648004 | - | NZ_CP014161.1 | Aerococcus urinae |
| 115 | 34273 | 34404 | + | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 116 | 1400695 | 1400844 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 117 | 662169 | 662330 | - | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 118 | 1279102 | 1279233 | - | NZ_CP011391.1 | Faecalibaculum rodentium |
| 119 | 324517 | 324666 | + | NC_022549.1 | Acholeplasma brassicae |
| 120 | 129349 | 129495 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 121 | 2381223 | 2381378 | - | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 122 | 36602 | 36736 | + | NZ_CP046276.1 | Spiroplasma tabanidicola |
| 123 | 119834 | 119965 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 124 | 134056 | 134205 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 125 | 1511115 | 1511264 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 126 | 90575 | 90724 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 127 | 1428189 | 1428338 | - | NZ_CP043404.1 | Bacillus safensis |
| 128 | 1326216 | 1326356 | - | NZ_CP042997.1 | Aquisphaera giovannonii |
| 129 | 3953583 | 3953732 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 130 | 654375 | 654527 | - | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 131 | 1980872 | 1981036 | + | NZ_CP038452.1 | Thermus caldilimi |
| 132 | 662805 | 662957 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 133 | 909 | 1079 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 134 | 2897874 | 2898023 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 135 | 250061 | 250210 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 136 | 197216 | 197353 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 137 | 1652467 | 1652637 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 138 | 34499 | 34660 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 139 | 391149 | 391307 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 140 | 399052 | 399210 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 141 | 414076 | 414234 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 142 | 422516 | 422674 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 143 | 427619 | 427759 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 144 | 455016 | 455174 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 145 | 3287770 | 3287919 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 146 | 1107501 | 1107659 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 147 | 61066 | 61227 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 148 | 380319 | 380483 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 149 | 1089178 | 1089336 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 150 | 133145 | 133276 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 151 | 202343 | 202492 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 152 | 948120 | 948272 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 153 | 621010 | 621162 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 154 | 410131 | 410289 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 155 | 971343 | 971492 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 156 | 54285 | 54443 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 157 | 1309116 | 1309274 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 158 | 435660 | 435818 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 159 | 316235 | 316393 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 160 | 3949599 | 3949730 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 161 | 370821 | 370961 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 162 | 160392 | 160541 | + | NZ_CP034118.1 | Staphylospora marina |
| 163 | 3188660 | 3188791 | - | NZ_CP030280.1 | Blautia argi |
| 164 | 353647 | 353796 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 165 | 2283383 | 2283532 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 166 | 756165 | 756335 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 167 | 776946 | 777074 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 168 | 173485 | 173604 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 169 | 1800956 | 1801105 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 170 | 5126600 | 5126719 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 171 | 215847 | 215978 | + | NZ_LR699011.1 | Roseburia hominis |
| 172 | 449093 | 449260 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 173 | 1483200 | 1483331 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 174 | 5952270 | 5952401 | - | NZ_CP039126.1 | Blautia producta |
| 175 | 34354 | 34515 | + | NZ_CP017015.1 | Spiroplasma helicoides |
| 176 | 1223135 | 1223287 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 177 | 188299 | 188421 | + | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 178 | 420686 | 420850 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 179 | 3655008 | 3655139 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 180 | 3803049 | 3803168 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 181 | 4458133 | 4458264 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 182 | 507320 | 507439 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 183 | 3385898 | 3386017 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 184 | 3853656 | 3853775 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 185 | 1399354 | 1399497 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 186 | 1137032 | 1137175 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 187 | 1020474 | 1020617 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 188 | 1231796 | 1231939 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 189 | 1623368 | 1623511 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 190 | 1350126 | 1350269 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 191 | 1621656 | 1621799 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 192 | 5575536 | 5575655 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 193 | 3129739 | 3129870 | - | NZ_CP048813.1 | Rhodococcus triatomae |
| 194 | 3555120 | 3555239 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 195 | 1218762 | 1218914 | + | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 196 | 359396 | 359566 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 197 | 1591704 | 1591874 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 198 | 929885 | 930004 | - | NZ_CP008802.1 | Actinotignum schaalii |
| 199 | 3881804 | 3881923 | + | NZ_LS483468.1 | Rhodococcus coprophilus |
| 200 | 4296390 | 4296509 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 201 | 3943624 | 3943743 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 202 | 1767501 | 1767632 | + | NZ_AP023172.1 | Rhodococcus qingshengii |
| 203 | 2992597 | 2992728 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 204 | 50167 | 50325 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 205 | 4132756 | 4132875 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 206 | 1273704 | 1273853 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 207 | 415806 | 415955 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 208 | 3698829 | 3698978 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 209 | 1393571 | 1393690 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 210 | 2379500 | 2379619 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 211 | 1016824 | 1016976 | + | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 212 | 7331746 | 7331877 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 213 | 1195172 | 1195312 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 214 | 4797918 | 4798037 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 215 | 448082 | 448249 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 216 | 2563046 | 2563189 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 217 | 2191504 | 2191653 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00584.22 | 0.88 | 190 | 56.0 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
| 2 | PF02357.21 | 0.83 | 178 | 333 | same-strand | Transcription termination factor nusG |
| 3 | PF00467.31 | 0.64 | 138 | 341.0 | same-strand | KOW motif |
| 4 | PF03946.16 | 0.87 | 187 | 1049 | same-strand | Ribosomal protein L11, N-terminal domain |
| 5 | PF00298.21 | 0.87 | 187 | 1049.0 | same-strand | Ribosomal protein L11, RNA binding domain |
| 6 | PF00687.23 | 0.78 | 167 | 1611.5 | same-strand | Ribosomal protein L1p/L10e family |
| 7 | PF00466.22 | 0.7 | 151 | 2565.0 | same-strand | Ribosomal protein L10 |
++ More..