ProsmORF-pred
Result : EXP01738
Protein Information
Information Type Description
Protein name EXP01738
NCBI Accession ID BA000022.2
Organism Synechocystis sp. PCC 6803
Left 3116440
Right 3116682
Strand -
Nucleotide Sequence ATGGGAGGATTGACCGTGAATCTAGAAACTCTGGAATTCGTCATTTACCCCGACGGCCGGGTGAAGGAAACGGTAACCGGCATTGTGGGTCGCTCTTGTCAGGAAGTGACCGCGGCGATCGAGGCCGAACTAGGGGTAGTGCTTACCCAGCAGACTACTTCGGAGTTTTTTGCCCAAACCAGTCCGTTGAACCAATCAGTTCAGCAATCCCAGACTCTTTCTAGCTGGCCTGGGGGAAGTTAA
Sequence MGGLTVNLETLEFVIYPDGRVKETVTGIVGRSCQEVTAAIEAELGVVLTQQTTSEFFAQTSPLNQSVQQSQTLSSWPGGS
Source of smORF Protein-level
Function The ORF matches to the profile of pfam11211. Profile Description: Protein of unknown function (DUF2997). This family of proteins has no known function.
Pubmed ID 30796087
Domain CDD:402681
Functional Category Conserved domain based functional assignment
Uniprot ID
ORF Length (Amino Acid) 80
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 23
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1904206 1904415 - NC_019748.1 Stanieria cyanosphaera PCC 7437
2 3413224 3413433 - NC_019689.1 Pleurocapsa sp. PCC 7327
3 2678293 2678502 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
4 5562289 5562510 + NC_014501.1 Gloeothece verrucosa PCC 7822
5 933939 934160 + NC_011729.1 Gloeothece citriformis PCC 7424
6 6355154 6355366 - NC_019771.1 Anabaena cylindrica PCC 7122
7 4784014 4784229 + NC_010296.1 Microcystis aeruginosa NIES-843
8 3852339 3852548 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
9 847935 848144 + NC_019693.1 Oscillatoria acuminata PCC 6304
10 4585944 4586165 + NZ_CP047242.1 Trichormus variabilis 0441
11 5483246 5483461 - NZ_CP021983.2 Halomicronema hongdechloris C2206
12 1742735 1742944 + NC_019751.1 Calothrix sp. PCC 6303
13 1728865 1729074 - NC_009925.1 Acaryochloris marina MBIC11017
14 3161371 3161580 - NZ_CP031941.1 Nostoc sphaeroides
15 4601481 4601690 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
16 159656 159877 - NC_010628.1 Nostoc punctiforme PCC 73102
17 1039579 1039788 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
18 4637154 4637369 - NC_019753.1 Crinalium epipsammum PCC 9333
19 3651969 3652184 + NC_019780.1 Dactylococcopsis salina PCC 8305
20 95957 96169 - NC_014248.1 'Nostoc azollae' 0708
21 3981275 3981493 - NC_019776.1 Cyanobacterium aponinum PCC 10605
22 2663146 2663358 - NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
23 419749 419961 - NZ_CP018092.1 Synechococcus lividus PCC 6715
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_019748.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF13370.8 1.0 23 431 same-strand 4Fe-4S single cluster domain of Ferredoxin I
2 PF13459.8 1.0 23 431 same-strand 4Fe-4S single cluster domain
3 PF06868.13 1.0 23 41 same-strand Protein of unknown function (DUF1257)
++ More..