Result : EXP01737
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01737 |
| NCBI Accession ID | NC_000912.1 |
| Organism | Mycoplasma pneumoniae M129 |
| Left | 574090 |
| Right | 574251 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGTTAAGAGAAGCACACGGCTAGGATGTAATGATTGTCGTGAAATTAACTATCTAACGTTTAAAAACGTCAAGAAAAACCCTGAAAAACTTGCCCTCAACAAGTTTTGTTCGCGTTGTCGCAAGGTAGTAGTACACAAGGAAGTAAAACGAAAATAA |
| Sequence | MAVKRSTRLGCNDCREINYLTFKNVKKNPEKLALNKFCSRCRKVVVHKEVKRK |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];ribosome [GO:0005840];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00383. Profile Description: Ribosomal protein L33. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:412348 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q7NB34 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 129
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 568978 | 569139 | - | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 2 | 408793 | 408954 | - | NC_000908.2 | Mycoplasma genitalium G37 |
| 3 | 584928 | 585089 | - | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 4 | 535364 | 535525 | - | NZ_CP059674.1 | Mycoplasma tullyi |
| 5 | 842469 | 842630 | - | NZ_LR215023.1 | Mycoplasma iowae |
| 6 | 511376 | 511537 | + | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 7 | 745339 | 745500 | - | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
| 8 | 662118 | 662279 | - | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 9 | 1378223 | 1378363 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 10 | 1332868 | 1332999 | + | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 11 | 382593 | 382742 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 12 | 504368 | 504532 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 13 | 1208797 | 1208946 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 14 | 370821 | 370961 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 15 | 2261640 | 2261789 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 16 | 1678000 | 1678131 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 17 | 1460124 | 1460255 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 18 | 621745 | 621885 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 19 | 1479048 | 1479197 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 1268878 | 1269018 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 21 | 2148214 | 2148363 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 22 | 1545342 | 1545491 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 23 | 1508308 | 1508457 | + | NZ_CP016538.2 | Planococcus maritimus |
| 24 | 1518340 | 1518489 | + | NZ_CP059540.1 | Planococcus maritimus |
| 25 | 1262245 | 1262394 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 26 | 1127430 | 1127579 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 27 | 2475502 | 2475633 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 28 | 3462703 | 3462834 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 29 | 1288894 | 1289043 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 30 | 1126470 | 1126619 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 31 | 1358160 | 1358312 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 32 | 449093 | 449260 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 33 | 1461233 | 1461382 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 34 | 1516149 | 1516298 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 35 | 223658 | 223807 | - | NZ_CP013661.2 | Planococcus kocurii |
| 36 | 1559065 | 1559214 | + | NZ_CP019401.1 | Planococcus faecalis |
| 37 | 1671966 | 1672115 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 38 | 391149 | 391307 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 39 | 399052 | 399210 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 40 | 414076 | 414234 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 41 | 422516 | 422674 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 42 | 427619 | 427759 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 43 | 2527408 | 2527557 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 44 | 1138950 | 1139099 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 45 | 2020124 | 2020273 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 46 | 410131 | 410289 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 47 | 3704768 | 3704920 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 48 | 1081283 | 1081435 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 49 | 804150 | 804281 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 50 | 632372 | 632521 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 51 | 1749164 | 1749295 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 52 | 2554443 | 2554616 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 53 | 616315 | 616464 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 54 | 2937948 | 2938097 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 55 | 1716621 | 1716770 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 56 | 1706651 | 1706800 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 57 | 1089178 | 1089336 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 58 | 1733283 | 1733432 | - | NZ_CP016540.2 | Planococcus versutus |
| 59 | 909 | 1079 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 60 | 2481833 | 2481982 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 61 | 1652467 | 1652637 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 62 | 1107501 | 1107659 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 63 | 1297547 | 1297696 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 64 | 1310405 | 1310554 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 65 | 1647608 | 1647742 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 66 | 455016 | 455174 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 67 | 4437819 | 4437983 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 68 | 1837503 | 1837655 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 69 | 54285 | 54443 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 70 | 1309116 | 1309274 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 71 | 435660 | 435818 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 72 | 316235 | 316393 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 73 | 621010 | 621162 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 74 | 355622 | 355780 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 75 | 350767 | 350925 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 76 | 50167 | 50325 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 77 | 3530151 | 3530300 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 78 | 1470859 | 1471008 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 79 | 984158 | 984307 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 80 | 1046443 | 1046592 | + | NZ_CP065211.1 | Enterococcus lactis |
| 81 | 1699003 | 1699152 | + | NZ_CP023011.2 | Enterococcus hirae |
| 82 | 1713901 | 1714050 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 83 | 1317294 | 1317452 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 84 | 846731 | 846880 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 85 | 6265362 | 6265526 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 86 | 756165 | 756335 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 87 | 794900 | 795052 | - | NZ_AP022325.1 | Mycoplasmopsis felis |
| 88 | 407181 | 407339 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 89 | 1665571 | 1665720 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 90 | 1633868 | 1634017 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 91 | 1779703 | 1779852 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 92 | 3227382 | 3227513 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 93 | 1535048 | 1535179 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 94 | 384423 | 384560 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 95 | 326749 | 326907 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 96 | 2353708 | 2353866 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 97 | 478238 | 478396 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 98 | 453617 | 453775 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 99 | 510667 | 510837 | + | NZ_CP012544.1 | Campylobacter showae |
| 100 | 1915853 | 1916023 | - | NZ_CP012543.1 | Campylobacter rectus |
| 101 | 1668630 | 1668803 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 102 | 24682 | 24816 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 103 | 768871 | 769020 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 104 | 2460487 | 2460642 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 105 | 238738 | 238872 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 106 | 253871 | 254023 | - | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 107 | 4940291 | 4940455 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 108 | 1130043 | 1130174 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 109 | 244023 | 244175 | - | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 110 | 3607665 | 3607829 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 111 | 3594798 | 3594962 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 112 | 113063 | 113227 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 113 | 128477 | 128629 | - | NZ_CP029258.1 | Mycoplasmopsis synoviae |
| 114 | 250206 | 250337 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 115 | 83203 | 83334 | + | NZ_LT906439.1 | Streptococcus merionis |
| 116 | 1409375 | 1409533 | - | NZ_CP053826.1 | Campylobacter curvus |
| 117 | 394443 | 394595 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 118 | 328325 | 328462 | + | NZ_CP054142.1 | Treponema parvum |
| 119 | 1394814 | 1394972 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 120 | 1227864 | 1228016 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 121 | 545118 | 545270 | - | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 122 | 526529 | 526681 | + | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 123 | 2624033 | 2624191 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 124 | 705338 | 705487 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 125 | 1195172 | 1195342 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 126 | 3385526 | 3385657 | + | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 127 | 2563046 | 2563189 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 128 | 1466027 | 1466194 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 129 | 1527709 | 1527846 | + | NZ_CP030840.1 | Acidisarcina polymorpha |
| 130 | 446976 | 447149 | + | NZ_CP053831.1 | Campylobacter mucosalis |
++ More..