Result : EXP01733
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01733 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 470006 |
| Right | 470194 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAAAAGATGCACTTTAACTTTCAAAGGGCCTATGATAGGCAATCATGTCAGTCATGCGAACAACAAAAACAAGCGCCGCTTGCTCCCTAACTTGCGATCCATTAAGATCCAGTTAGACGACGGCACGACCAAACGCATTAAGGTGGCTGCTTCCACTTTAAGAACCATGCGTAAAGGGGCTTAG |
| Sequence | MAKRCTLTFKGPMIGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTKRIKVAASTLRTMRKGA |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];ribosome [GO:0005840];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:412338 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | A6QC89 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 89
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 477238 | 477426 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 319981 | 320169 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 3 | 702502 | 702690 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 4 | 312358 | 312546 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 5 | 1158443 | 1158634 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 6 | 731504 | 731695 | - | NZ_CP012541.1 | Campylobacter concisus |
| 7 | 1265235 | 1265426 | + | NZ_CP053826.1 | Campylobacter curvus |
| 8 | 1452420 | 1452608 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 9 | 1624878 | 1625066 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 10 | 1648539 | 1648727 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 11 | 2006563 | 2006751 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 12 | 515774 | 515962 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 13 | 1455966 | 1456157 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 14 | 1031137 | 1031331 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 15 | 878304 | 878495 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 16 | 829338 | 829526 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 17 | 170645 | 170854 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 18 | 291868 | 292077 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 19 | 610559 | 610750 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 20 | 980558 | 980749 | + | NZ_CP059443.1 | Campylobacter fetus |
| 21 | 1100348 | 1100539 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 22 | 2159498 | 2159686 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 23 | 426893 | 427084 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 24 | 723422 | 723610 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 25 | 1764698 | 1764886 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 26 | 943920 | 944114 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 27 | 828321 | 828512 | + | NZ_CP012543.1 | Campylobacter rectus |
| 28 | 1303716 | 1303907 | - | NZ_CP012544.1 | Campylobacter showae |
| 29 | 1550726 | 1550914 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 30 | 853778 | 853972 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 31 | 722113 | 722307 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 32 | 752548 | 752742 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 33 | 1031393 | 1031584 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 34 | 1250147 | 1250335 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 35 | 960336 | 960530 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 36 | 1813965 | 1814156 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 37 | 983037 | 983231 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 38 | 1018906 | 1019100 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 39 | 1074501 | 1074695 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 40 | 326603 | 326791 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 41 | 1093621 | 1093812 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 42 | 416651 | 416845 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 43 | 136454 | 136666 | - | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 44 | 887867 | 888055 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 45 | 1904778 | 1904966 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 46 | 1754730 | 1754921 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 47 | 85273 | 85467 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 48 | 392132 | 392326 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 49 | 917305 | 917493 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 50 | 35307 | 35501 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 51 | 1256413 | 1256607 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 52 | 2231961 | 2232149 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 53 | 2036526 | 2036714 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 54 | 1738056 | 1738244 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 55 | 368688 | 368876 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 56 | 1635708 | 1635902 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 57 | 1932143 | 1932331 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 58 | 1915154 | 1915342 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 59 | 2073641 | 2073829 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 60 | 559974 | 560162 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 61 | 1956705 | 1956893 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 62 | 1993793 | 1993981 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 63 | 497586 | 497774 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 64 | 1682958 | 1683146 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 65 | 2055680 | 2055868 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 66 | 387276 | 387464 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 67 | 554245 | 554433 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 68 | 2069633 | 2069821 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 69 | 1960043 | 1960231 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 70 | 1949836 | 1950024 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 71 | 1945781 | 1945969 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 72 | 2342186 | 2342374 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 73 | 2479132 | 2479320 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 74 | 1383552 | 1383740 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 75 | 482082 | 482270 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 76 | 2155635 | 2155823 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 77 | 2387390 | 2387578 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 78 | 1453622 | 1453810 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 79 | 1396935 | 1397135 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 80 | 93627 | 93827 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 81 | 1229619 | 1229810 | + | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 82 | 2530059 | 2530250 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 83 | 1149930 | 1150121 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 84 | 1919375 | 1919560 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 85 | 1642582 | 1642779 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 86 | 590425 | 590613 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 87 | 3628791 | 3629000 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 88 | 617399 | 617605 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 89 | 4515650 | 4515856 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019684.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02254.20 | 0.7 | 62 | 25.0 | same-strand | TrkA-N domain |
| 2 | PF02080.23 | 0.7 | 62 | 25.0 | same-strand | TrkA-C domain |
| 3 | PF04325.15 | 0.71 | 63 | 2393 | same-strand | Protein of unknown function (DUF465) |
| 4 | PF01960.20 | 0.61 | 54 | 1149.0 | same-strand | ArgJ family |
++ More..