Result : EXP01725
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01725 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 2084922 |
| Right | 2085206 |
| Strand | + |
| Nucleotide Sequence | ATGAATTCACTTTCTTTTGAATGGGACGAAGAAAAGAATCGAACCAATCAGAAAAAACATGGTATTTCTTTTGAGGAAGCTGAGACTGTTTTCTACGATGACAATGCTATTCAGTTTTGGGATGATAATCATTCAGAAGTAGAAGATAGATTCCTAATGCTGGGTAGAAGTTCCAGAATGAGAATCCTGCTAATTGTTCACTGCTTCCAAGAGAATGAATCTATCATCAGAATTATTTCTGCTCGCAAGGCTACTCCTAAAGAAACGAAACAATATAGAGGATAA |
| Sequence | MNSLSFEWDEEKNRTNQKKHGISFEEAETVFYDDNAIQFWDDNHSEVEDRFLMLGRSSRMRILLIVHCFQENESIIRIISARKATPKETKQYRG |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl01108. Profile Description: Ribonuclease toxin, BrnT, of type II toxin-antitoxin system. BrnT is a ribonuclease toxin of a type II toxin-antitoxin system that exhibits a RelE-like fold. The antitoxin that neutralizes this toxin is pfam14384. BrnT is found in bacteria, archaea, bacteriophage, and plasmids. BrnT-BrnA forms a 2:2 tetrameric complex and autoregulates its own expression, which is induced by a number of different environmental stresses. Expression of BrnT alone results in cessation of bacterial growth which can be rescued after subsequent expression of BrnA. |
| Pubmed ID | 30796087 |
| Domain | CDD:412746 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5610987 | 5611271 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 2 | 5608654 | 5608929 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 3 | 6629109 | 6629402 | + | NZ_CP061799.1 | Desulfonema limicola |
| 4 | 8395 | 8688 | - | NC_002971.4 | Coxiella burnetii RSA 493 |
| 5 | 2354018 | 2354302 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 6 | 1827650 | 1827931 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 7 | 783838 | 784131 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 8 | 1189049 | 1189327 | - | NZ_CP007501.1 | Polynucleobacter duraquae |
| 9 | 2117469 | 2117771 | + | NZ_CP009228.1 | Treponema putidum |
| 10 | 1255074 | 1255376 | - | NZ_CP009228.1 | Treponema putidum |
| 11 | 1508330 | 1508608 | + | NZ_CP023276.1 | Polynucleobacter difficilis |
| 12 | 2390601 | 2390894 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 13 | 7628697 | 7628990 | + | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 14 | 448387 | 448665 | - | NZ_CP029556.1 | Lysobacter oculi |
| 15 | 3372690 | 3372953 | - | NZ_CP011797.1 | Reinekea forsetii |
| 16 | 1185576 | 1185863 | + | NZ_AP017372.2 | Halorhodospira halochloris |
| 17 | 4503187 | 4503441 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 18 | 2352591 | 2352845 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 19 | 2091715 | 2091999 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 20 | 256285 | 256563 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 21 | 1357974 | 1358258 | - | NZ_LS483250.1 | Moritella yayanosii |
| 22 | 3830685 | 3830981 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 23 | 872795 | 873088 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 24 | 1004701 | 1004979 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 25 | 3079390 | 3079620 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 26 | 4820923 | 4821216 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 27 | 721505 | 721792 | + | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 28 | 528417 | 528704 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 29 | 1262 | 1540 | + | NZ_CP053829.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 30 | 580749 | 581030 | + | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 31 | 3565303 | 3565590 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 32 | 3301278 | 3301571 | + | NZ_CP048812.1 | Halomonas socia |
| 33 | 4456193 | 4456486 | - | NZ_CP048711.1 | Kineobactrum salinum |
| 34 | 1665352 | 1665645 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 35 | 514857 | 515150 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 36 | 121024 | 121302 | - | NZ_CP060711.1 | Thermomonas brevis |
| 37 | 1277127 | 1277372 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 38 | 1050929 | 1051207 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 39 | 6693898 | 6694182 | - | NZ_CP061800.1 | Desulfonema magnum |
| 40 | 514798 | 515091 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 41 | 1009013 | 1009285 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 42 | 1208607 | 1208870 | + | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 43 | 4844173 | 4844451 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 44 | 260854 | 261135 | + | NZ_CP054142.1 | Treponema parvum |
++ More..