Result : EXP01724
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01724 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 928566 |
| Right | 928772 |
| Strand | - |
| Nucleotide Sequence | ATGCCGTTTATCAATATCAAACTCGTGCCAGAAAATGGAGGGCCAACAAACGAGCAAAAACAGCAATTGATTGAAGGGGTTTCAGATTTGATGGTTAAGGTGTTAAACAAAAATAAGGCTTCTATTGTGGTCATTATAGATGAGGTCGATTCTAATAATTATGGTCTTGGGGGCGAGAGCATCCATCATTTGAGGCAAAAAAACTAA |
| Sequence | MPFINIKLVPENGGPTNEQKQQLIEGVSDLMVKVLNKNKASIVVIIDEVDSNNYGLGGESIHHLRQKN |
| Source of smORF | Protein-level |
| Function | cellular aromatic compound metabolic process [GO:0006725];isomerase activity [GO:0016853] The ORF matches to the profile of cl00235. Profile Description: N/A. This family includes the enzyme 4-oxalocrotonate tautomerase, which catalyzes the ketonisation of 2-hydroxymuconate to 2-oxo-3-hexenedioate. |
| Pubmed ID | 30796087 |
| Domain | CDD:412246 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | O25581 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 121
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 937769 | 937975 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1261253 | 1261465 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 3 | 1516327 | 1516539 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 1159373 | 1159579 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 5 | 1186290 | 1186499 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 6 | 1371749 | 1371973 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 7 | 1061427 | 1061636 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 8 | 1413684 | 1413893 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 9 | 1193136 | 1193354 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 10 | 1487775 | 1488005 | - | NZ_CP053826.1 | Campylobacter curvus |
| 11 | 1600872 | 1601075 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 12 | 1482167 | 1482373 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 13 | 400662 | 400868 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 14 | 131726 | 131950 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 15 | 384696 | 384905 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 16 | 953235 | 953432 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 17 | 1632547 | 1632756 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 18 | 3829259 | 3829456 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 19 | 3805784 | 3805981 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 20 | 825122 | 825331 | - | NZ_LS483470.1 | Leminorella richardii |
| 21 | 2217930 | 2218130 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 22 | 3547801 | 3547998 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 23 | 1456005 | 1456220 | - | NZ_CP059443.1 | Campylobacter fetus |
| 24 | 2307658 | 2307858 | + | NZ_LR134531.1 | Pragia fontium |
| 25 | 1692774 | 1692983 | - | NZ_CP031699.1 | Neisseria animalis |
| 26 | 2117989 | 2118207 | + | NZ_CP011381.2 | Moraxella bovoculi |
| 27 | 2244372 | 2244590 | + | NZ_CP011158.1 | Moraxella ovis |
| 28 | 1303448 | 1303651 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 29 | 1388924 | 1389130 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 30 | 4914147 | 4914353 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 31 | 3002220 | 3002423 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 32 | 1428281 | 1428487 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 33 | 2063415 | 2063615 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 34 | 292807 | 293013 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 35 | 148787 | 148990 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 36 | 4539517 | 4539717 | + | NZ_CP043727.1 | Yersinia canariae |
| 37 | 2848637 | 2848837 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 38 | 145483 | 145683 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 39 | 2739706 | 2739906 | + | NZ_CP009787.1 | Yersinia rohdei |
| 40 | 4561835 | 4562035 | + | NZ_CP032487.1 | Yersinia hibernica |
| 41 | 891194 | 891397 | - | NZ_CP046269.1 | Vibrio spartinae |
| 42 | 291073 | 291279 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 43 | 1352038 | 1352244 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 44 | 139357 | 139560 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 45 | 3089404 | 3089601 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 46 | 1444843 | 1445043 | + | NZ_CP007230.1 | Yersinia similis |
| 47 | 4912506 | 4912706 | - | NZ_CP046293.1 | Yersinia intermedia |
| 48 | 3548207 | 3548413 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 49 | 4462229 | 4462429 | + | NZ_CP050150.1 | Hafnia alvei |
| 50 | 2610797 | 2610994 | - | NZ_CP061081.1 | Marinomonas arctica |
| 51 | 5281299 | 5281520 | + | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 52 | 1396773 | 1396973 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 53 | 1520150 | 1520353 | + | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 54 | 4366408 | 4366614 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 55 | 742782 | 742985 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 56 | 1968915 | 1969130 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 57 | 5151493 | 5151696 | + | NZ_LR134494.1 | Serratia quinivorans |
| 58 | 2224490 | 2224708 | - | NZ_LR134494.1 | Serratia quinivorans |
| 59 | 582336 | 582554 | + | NZ_CP072524.1 | Neisseria sicca |
| 60 | 144124 | 144336 | - | NZ_CP013232.1 | Collimonas fungivorans |
| 61 | 260437 | 260643 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 62 | 2698195 | 2698425 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 63 | 134744 | 134944 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 64 | 4709474 | 4709704 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 65 | 1848160 | 1848360 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 66 | 3116421 | 3116624 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 67 | 755754 | 755969 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 68 | 861891 | 862094 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 69 | 342299 | 342499 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 70 | 3924775 | 3924978 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 71 | 834538 | 834741 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 72 | 4056511 | 4056717 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 73 | 3561120 | 3561335 | - | NZ_CP041970.1 | Acinetobacter dispersus |
| 74 | 4545463 | 4545666 | + | NZ_CP025799.1 | Dickeya zeae |
| 75 | 4528760 | 4528966 | + | NZ_CP021425.1 | Oleiphilus messinensis |
| 76 | 1673887 | 1674084 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 77 | 900572 | 900769 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 78 | 492056 | 492262 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 79 | 13352 | 13555 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 80 | 1161426 | 1161629 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 81 | 106741 | 106944 | - | NZ_LT615367.1 | Dickeya aquatica |
| 82 | 2439108 | 2439308 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 83 | 1465835 | 1466035 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 84 | 1687228 | 1687431 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 85 | 1504126 | 1504335 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 86 | 2286242 | 2286448 | - | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 87 | 1261495 | 1261707 | + | NZ_LT996885.1 | Dialister massiliensis |
| 88 | 4567167 | 4567382 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 89 | 912588 | 912818 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 90 | 3105822 | 3106052 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 91 | 1189585 | 1189791 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 92 | 1403781 | 1403984 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 93 | 3291626 | 3291829 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 94 | 4051024 | 4051221 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 95 | 898608 | 898811 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 96 | 5002625 | 5002831 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 97 | 262904 | 263110 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 98 | 2258434 | 2258637 | - | NZ_CP031466.1 | Paraburkholderia caffeinilytica |
| 99 | 1864291 | 1864500 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 100 | 3487774 | 3487980 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 101 | 5236861 | 5237064 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 102 | 1151866 | 1152072 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 103 | 484221 | 484436 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 104 | 3773586 | 3773789 | - | NZ_CP067057.1 | Rahnella aceris |
| 105 | 1265509 | 1265718 | + | NZ_CP026364.1 | Proteus hauseri |
| 106 | 3113684 | 3113890 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 107 | 4596594 | 4596797 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 108 | 178145 | 178351 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 109 | 232966 | 233172 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 110 | 1091262 | 1091468 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 111 | 4715805 | 4716008 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 112 | 1957204 | 1957407 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 113 | 2733135 | 2733347 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 114 | 2388380 | 2388580 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 115 | 2222559 | 2222765 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 116 | 326397 | 326603 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 117 | 3991691 | 3991897 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 118 | 2281375 | 2281572 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 119 | 1530950 | 1531153 | + | NZ_CP011254.1 | Serratia fonticola |
| 120 | 5097165 | 5097368 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 121 | 1702098 | 1702301 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 122 | 3648517 | 3648726 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 123 | 1113288 | 1113506 | + | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 124 | 3339939 | 3340166 | + | NZ_CP019236.1 | Rhodoferax koreense |
| 125 | 4080700 | 4080918 | - | NZ_AP017422.1 | Filimonas lacunae |
| 126 | 2718832 | 2719065 | - | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 127 | 3438804 | 3439010 | + | NZ_CP047045.1 | Terricaulis silvestris |
| 128 | 3165096 | 3165305 | - | NZ_CP024201.1 | Caulobacter mirabilis |
++ More..