Result : EXP01721
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01721 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 2957125 |
| Right | 2957364 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTAACGATACACTTTTTGCCTGACGATGTGACGGTAGCGGCCCGGGTAGGGGAACCAATCTTAGATGTGGCAGAGAGGGCTGGCGTATTTATTCCCACGGGCTGTTTAATGGGTTCCTGCCATGCTTGCGAAGTGGAACTAGGGGATGGCACTCCCATTTGCGCTTGTATTAGTGCGGTGCCAGTAGGGGTACAGGAATTAGAAATTAATCTTTATGATGATCTCACCTGGTAG |
| Sequence | MAVTIHFLPDDVTVAARVGEPILDVAERAGVFIPTGCLMGSCHACEVELGDGTPICACISAVPVGVQELEINLYDDLTW |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00159. Profile Description: N/A. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins. |
| Pubmed ID | 30796087 |
| Domain | CDD:412190 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4480698 | 4480937 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 2 | 2630230 | 2630469 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 3 | 2405901 | 2406137 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 4 | 311398 | 311637 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 5 | 1988637 | 1988864 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 6 | 4068930 | 4069169 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 7 | 2224515 | 2224757 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 8 | 4575299 | 4575538 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 9 | 2762331 | 2762567 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 10 | 1544527 | 1544766 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 11 | 598258 | 598494 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 12 | 6255588 | 6255827 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 13 | 2643545 | 2643784 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 14 | 15029 | 15265 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 15 | 5290081 | 5290317 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 16 | 4671625 | 4671861 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 17 | 2630699 | 2630938 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 18 | 5963580 | 5963786 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 19 | 241368 | 241607 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 20 | 3967829 | 3968068 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 21 | 303287 | 303526 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 22 | 80081 | 80323 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 23 | 5271203 | 5271442 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 24 | 3909678 | 3909917 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 25 | 1762520 | 1762717 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 26 | 4352271 | 4352486 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 27 | 608464 | 608664 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019748.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07685.16 | 0.74 | 20 | 76.5 | same-strand | CobB/CobQ-like glutamine amidotransferase domain |
| 2 | PF13500.8 | 0.7 | 19 | 87 | same-strand | AAA domain |
| 3 | PF01656.25 | 0.74 | 20 | 87 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
++ More..