Result : B2V6V2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP001080.1 |
| Organism | Sulfurihydrogenibium sp. (strain YO3AOP1) |
| Left | 1749203 |
| Right | 1749409 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAAGGTTAAAATGAAAACTAATAGAACAGCAGCTAAAAGATTAAAAATCACTGCTACCGGAAAAGTTAAGTACACAAAGGGCGGAGTTTCTCACTACAACACTAAAAAATCTTCTAAAAGAAAAAGACAAGGAAGAAAGCCACAATACGTTCCAAAGAATTTAGAGCATAAAGTGAAAGCACTTTTACCAAACGATGTTTAA |
| Sequence | MAKVKMKTNRTAAKRLKITATGKVKYTKGGVSHYNTKKSSKRKRQGRKPQYVPKNLEHKVKALLPNDV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19136599 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B2V6V2 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 101
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 423371 | 423574 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 2 | 70204 | 70410 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 3 | 547720 | 547923 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 4 | 1145043 | 1145246 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 5 | 450741 | 450944 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 6 | 1104795 | 1104995 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 7 | 1560150 | 1560338 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 8 | 10160203 | 10160391 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 9 | 10114624 | 10114812 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 10 | 297065 | 297256 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 11 | 916097 | 916285 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 12 | 1643463 | 1643666 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 13 | 1073784 | 1073972 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 14 | 3190382 | 3190585 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 15 | 2398507 | 2398695 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 16 | 3168799 | 3168987 | + | NZ_CP023671.1 | Clostridium septicum |
| 17 | 4748937 | 4749125 | - | NZ_CP020953.1 | Clostridium drakei |
| 18 | 5157326 | 5157514 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 19 | 3924771 | 3924959 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 20 | 868515 | 868703 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 21 | 6175981 | 6176178 | - | NZ_CP061799.1 | Desulfonema limicola |
| 22 | 526308 | 526505 | + | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 23 | 1649362 | 1649550 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 24 | 545290 | 545487 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 25 | 1615169 | 1615357 | + | NZ_CP040924.1 | Clostridium thermarum |
| 26 | 728029 | 728226 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 27 | 1791642 | 1791830 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 28 | 644299 | 644487 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 29 | 2771450 | 2771641 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 30 | 2302330 | 2302518 | - | NZ_CP035108.1 | Geovibrio thiophilus |
| 31 | 800587 | 800775 | + | NZ_CP016786.1 | Clostridium isatidis |
| 32 | 1437079 | 1437267 | - | NZ_CP016786.1 | Clostridium isatidis |
| 33 | 3308058 | 3308246 | - | NZ_CP028842.1 | Clostridium botulinum |
| 34 | 3551061 | 3551249 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 35 | 2388455 | 2388643 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 36 | 859202 | 859390 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 37 | 3065807 | 3065995 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 38 | 2098968 | 2099153 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 39 | 2871103 | 2871291 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 40 | 1610237 | 1610425 | + | NZ_CP014176.1 | Clostridium argentinense |
| 41 | 2311684 | 2311872 | - | NZ_HG917868.1 | Clostridium bornimense |
| 42 | 798694 | 798882 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 43 | 1440403 | 1440591 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 44 | 3767216 | 3767404 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 45 | 3443121 | 3443318 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 46 | 1353807 | 1353995 | + | NZ_CP030775.1 | Clostridium butyricum |
| 47 | 871988 | 872176 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 48 | 1921318 | 1921506 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 49 | 2385902 | 2386090 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 50 | 2927697 | 2927885 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 51 | 3049662 | 3049850 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 52 | 1773115 | 1773303 | - | NZ_CP014204.2 | Clostridium baratii |
| 53 | 3016550 | 3016738 | - | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 54 | 1617613 | 1617801 | - | NZ_CP029256.1 | Christensenella minuta |
| 55 | 381375 | 381560 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 56 | 3199059 | 3199229 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 57 | 1522161 | 1522349 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 58 | 2345227 | 2345424 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 59 | 1722521 | 1722703 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 60 | 1138744 | 1138935 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 61 | 2411716 | 2411916 | - | NZ_CP048649.1 | Aminipila butyrica |
| 62 | 1641151 | 1641348 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 63 | 3793895 | 3794083 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 64 | 271907 | 272104 | + | NC_018020.1 | Turneriella parva DSM 21527 |
| 65 | 964803 | 964991 | + | NC_008593.1 | Clostridium novyi NT |
| 66 | 1796864 | 1797052 | + | NZ_CP043998.1 | Clostridium diolis |
| 67 | 371264 | 371449 | - | NC_012115.1 | Nautilia profundicola AmH |
| 68 | 867192 | 867392 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 69 | 3211173 | 3211370 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 70 | 775796 | 775993 | - | NZ_CP070062.1 | Coprococcus comes |
| 71 | 701697 | 701903 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 72 | 1649991 | 1650173 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 73 | 1461720 | 1461908 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 74 | 870474 | 870662 | + | NZ_CP044060.1 | Aeromonas veronii |
| 75 | 1068980 | 1069168 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 76 | 1791025 | 1791213 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 77 | 2330931 | 2331119 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 78 | 457804 | 457992 | - | NZ_LT996885.1 | Dialister massiliensis |
| 79 | 1419489 | 1419686 | + | NZ_CP015772.1 | Niabella ginsenosidivorans |
| 80 | 1603875 | 1604069 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 81 | 2278397 | 2278594 | - | NZ_LN879430.1 | Herbinix luporum |
| 82 | 1895967 | 1896152 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 83 | 1541152 | 1541343 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 84 | 1655710 | 1655916 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 85 | 1717279 | 1717470 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 86 | 857823 | 858011 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 87 | 2594866 | 2595054 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 88 | 3290268 | 3290465 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 89 | 200088 | 200276 | - | NC_011244.1 | Borrelia recurrentis A1 |
| 90 | 449610 | 449807 | + | NZ_CP042433.1 | Flavisolibacter ginsenosidimutans |
| 91 | 3982954 | 3983142 | - | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 92 | 321311 | 321508 | + | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 93 | 2760517 | 2760711 | + | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 94 | 2427264 | 2427446 | - | NZ_CP012543.1 | Campylobacter rectus |
| 95 | 60718 | 60900 | - | NZ_CP012544.1 | Campylobacter showae |
| 96 | 1695929 | 1696111 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 97 | 2640180 | 2640362 | - | NZ_CP011494.1 | Marinobacter psychrophilus |
| 98 | 1460629 | 1460811 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 99 | 911725 | 911910 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 100 | 2472260 | 2472448 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 101 | 2344947 | 2345135 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 102 | 1188317 | 1188505 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 103 | 2480305 | 2480493 | - | NZ_AP022188.1 | Aeromonas media |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003869.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01409.22 | 0.62 | 63 | 1646 | same-strand | tRNA synthetases class II core domain (F) |
| 2 | PF02912.20 | 0.61 | 62 | 1667.5 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 3 | PF00453.20 | 0.96 | 97 | 28 | same-strand | Ribosomal protein L20 |
| 4 | PF00707.24 | 0.8 | 81 | 31.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
++ More..