ProsmORF-pred
Result : EXP01705
Protein Information
Information Type Description
Protein name EXP01705
NCBI Accession ID NC_000911.1
Organism Synechocystis
Left 1141803
Right 1141946
Strand -
Nucleotide Sequence ATGAACAACGAAAACTCTAAATTTGGATTCACTGCTTTCGCCGAAAACTGGAATGGTCGCTTGGCCATGATCGGTTTTTCCTCTGCCCTGATCCTCGAGCTTGTCTCTGGGCAAGGTGTACTTCACTTCTTCGGCATTCTGTAA
Sequence MNNENSKFGFTAFAENWNGRLAMIGFSSALILELVSGQGVLHFFGIL
Source of smORF Literature
Function
Pubmed ID 30796087
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 47
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 30
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2232103 2232243 - NC_011729.1 Gloeothece citriformis PCC 7424
2 4480427 4480570 - NC_011729.1 Gloeothece citriformis PCC 7424
3 2415168 2415311 + NC_011729.1 Gloeothece citriformis PCC 7424
4 3649731 3649883 + NC_019689.1 Pleurocapsa sp. PCC 7327
5 3229365 3229508 - NC_019689.1 Pleurocapsa sp. PCC 7327
6 3549680 3549823 + NC_019689.1 Pleurocapsa sp. PCC 7327
7 2853657 2853803 + NC_019689.1 Pleurocapsa sp. PCC 7327
8 1410377 1410523 - NC_019689.1 Pleurocapsa sp. PCC 7327
9 4619338 4619481 + NC_009925.1 Acaryochloris marina MBIC11017
10 3271102 3271245 + NC_009925.1 Acaryochloris marina MBIC11017
11 1290056 1290199 + NC_009925.1 Acaryochloris marina MBIC11017
12 1572848 1572991 + NC_009925.1 Acaryochloris marina MBIC11017
13 3230482 3230634 + NC_009925.1 Acaryochloris marina MBIC11017
14 4619546 4619695 + NC_009925.1 Acaryochloris marina MBIC11017
15 3271710 3271862 + NC_009925.1 Acaryochloris marina MBIC11017
16 4620034 4620186 + NC_009925.1 Acaryochloris marina MBIC11017
17 577098 577247 + NC_019780.1 Dactylococcopsis salina PCC 8305
18 1922105 1922248 - NC_019780.1 Dactylococcopsis salina PCC 8305
19 1197251 1197394 - NC_019693.1 Oscillatoria acuminata PCC 6304
20 3027663 3027806 - NC_019693.1 Oscillatoria acuminata PCC 6304
21 92705 92854 + NZ_CP042326.1 Euhalothece natronophila Z-M001
22 92482 92631 + NZ_CP042326.1 Euhalothece natronophila Z-M001
23 1496823 1496966 + NZ_CP042326.1 Euhalothece natronophila Z-M001
24 1958675 1958806 + NZ_CP042326.1 Euhalothece natronophila Z-M001
25 3218880 3219023 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
26 1942664 1942807 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
27 3078514 3078663 - NZ_CP021983.2 Halomicronema hongdechloris C2206
28 4467126 4467269 + NZ_CP021983.2 Halomicronema hongdechloris C2206
29 6173469 6173597 - NZ_CP031941.1 Nostoc sphaeroides
30 349657 349785 - NZ_CP031941.1 Nostoc sphaeroides
31 4556520 4556636 - NZ_CP031941.1 Nostoc sphaeroides
32 1227769 1227897 + NC_010628.1 Nostoc punctiforme PCC 73102
33 1425906 1426034 + NC_010628.1 Nostoc punctiforme PCC 73102
34 3134371 3134517 + NC_010628.1 Nostoc punctiforme PCC 73102
35 7995430 7995558 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
36 6662549 6662677 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
37 3257257 3257403 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
38 4117867 4117995 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
39 6308612 6308740 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
40 6219563 6219709 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
41 2431910 2432035 - NZ_CP018092.1 Synechococcus lividus PCC 6715
42 2203534 2203683 - NZ_CP018092.1 Synechococcus lividus PCC 6715
43 1545463 1545621 - NC_005125.1 Gloeobacter violaceus PCC 7421
44 2873363 2873488 + NC_005125.1 Gloeobacter violaceus PCC 7421
45 3228721 3228837 - NZ_CP047242.1 Trichormus variabilis 0441
46 5737040 5737168 + NZ_CP047242.1 Trichormus variabilis 0441
47 4383501 4383659 + NC_022600.1 Gloeobacter kilaueensis JS1
48 680110 680268 - NC_022600.1 Gloeobacter kilaueensis JS1
49 189461 189604 + NC_019675.1 Cyanobium gracile PCC 6307
50 865174 865317 - NC_019675.1 Cyanobium gracile PCC 6307
51 1576056 1576202 + NC_019675.1 Cyanobium gracile PCC 6307
52 221973 222116 + NC_009929.1 Acaryochloris marina MBIC11017
53 222180 222332 + NC_009929.1 Acaryochloris marina MBIC11017
54 2034173 2034298 + NZ_AP018202.1 Thermostichus vulcanus NIES-2134
55 2168943 2169092 + NZ_AP018202.1 Thermostichus vulcanus NIES-2134
56 2160083 2160220 - NZ_AP018202.1 Thermostichus vulcanus NIES-2134
57 447602 447727 + NC_004113.1 Thermosynechococcus vestitus BP-1
58 2300394 2300543 + NC_004113.1 Thermosynechococcus vestitus BP-1
59 2292567 2292704 - NC_004113.1 Thermosynechococcus vestitus BP-1
60 2647931 2648074 - NC_019748.1 Stanieria cyanosphaera PCC 7437
61 314212 314355 - NC_019748.1 Stanieria cyanosphaera PCC 7437
62 2028139 2028282 + NC_019748.1 Stanieria cyanosphaera PCC 7437
63 4873651 4873797 + NC_019751.1 Calothrix sp. PCC 6303
64 3298032 3298175 + NC_019753.1 Crinalium epipsammum PCC 9333
65 4635528 4635680 - NC_019753.1 Crinalium epipsammum PCC 9333
66 3558609 3558752 - NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
67 861221 861358 - NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
68 1315030 1315173 + NC_014501.1 Gloeothece verrucosa PCC 7822
69 4055843 4055986 + NC_014501.1 Gloeothece verrucosa PCC 7822
70 3224264 3224407 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
71 466722 466844 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
72 5323789 5323932 + NC_019771.1 Anabaena cylindrica PCC 7122
73 3975537 3975677 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
74 2071230 2071346 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
75 3992441 3992587 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
76 2903194 2903352 - NC_014248.1 'Nostoc azollae' 0708
77 2183631 2183774 - NC_014248.1 'Nostoc azollae' 0708
78 1089878 1090021 + NC_019776.1 Cyanobacterium aponinum PCC 10605
79 1954600 1954743 + NC_019776.1 Cyanobacterium aponinum PCC 10605
80 1740190 1740327 + NC_019776.1 Cyanobacterium aponinum PCC 10605
81 837602 837745 - NC_010296.1 Microcystis aeruginosa NIES-843
82 5477797 5477943 + NC_010296.1 Microcystis aeruginosa NIES-843
83 77791 77946 - NC_009926.1 Acaryochloris marina MBIC11017
++ More..