Result : EXP01696
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01696 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 734665 |
| Right | 734859 |
| Strand | + |
| Nucleotide Sequence | ATGACTATTCAACTAACTGTACCCACCATTGCCTGTGAAGCCTGTGCCGAAGCTGTGACCAAAGCCGTGCAAAATGAGGATGCCCAAGCAACGGTGCAAGTGGATTTAACCAGCAAAAAAGTCACCATCACCAGTGCTCTGGGGGAAGAACAACTACGAACGGCGATCGCCTCGGCGGGCCATGAAGTTGAGTGA |
| Sequence | MTIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00207. Profile Description: N/A. This model describes an apparently copper-specific subfamily of the metal-binding domain HMA (pfam00403). Closely related sequences outside this model include mercury resistance proteins and repeated domains of eukaryotic eukaryotic copper transport proteins. Members of this family are strictly prokaryotic. The model identifies both small proteins consisting of just this domain and N-terminal regions of cation (probably copper) transporting ATPases. [Transport and binding proteins, Cations and iron carrying compounds] |
| Pubmed ID | 30796087 |
| Domain | CDD:412222 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3434677 | 3434874 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 2 | 3493519 | 3493716 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 4676576 | 4676776 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 4 | 1260177 | 1260347 | - | NZ_CP023276.1 | Polynucleobacter difficilis |
++ More..