Result : B2UZ25
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP001078.1 |
| Organism | Clostridium botulinum (strain Alaska E43 / Type E3) |
| Left | 416187 |
| Right | 416480 |
| Strand | + |
| Nucleotide Sequence | ATGTCTGTTACTAAAAAAGACGTTGAATATGTTGCAGAACTTGCAAGATTAAGTTTTAATGAAGATGAAAAAGAAAGTTTAGCATCTGATTTAAATCAAATTTTAAATTATGTTGAAAAACTTCAAGAATTGGATACTGAAAAGGAAGATATAATAGTAAACCCTTATTATATTGAAAACAAATTTAGAGAAGATGAAATTACCCCTTCAATTAAATTAGAAGAGGTTTTAGAAAATGCGCCTAAAACATTAGAAGAATATGTTTTAGTTCCAACAATTATAAGAGAACAATAG |
| Sequence | MSVTKKDVEYVAELARLSFNEDEKESLASDLNQILNYVEKLQELDTEKEDIIVNPYYIENKFREDEITPSIKLEEVLENAPKTLEEYVLVPTIIREQ |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | B2UZ25 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 414593 | 414883 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 2 | 3351779 | 3352069 | - | NZ_CP030775.1 | Clostridium butyricum |
| 3 | 1442841 | 1443128 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 4 | 3095594 | 3095881 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 5 | 2790302 | 2790589 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 6 | 3443242 | 3443529 | - | NZ_CP028842.1 | Clostridium botulinum |
| 7 | 2044052 | 2044342 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 8 | 3686681 | 3686968 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 9 | 3444701 | 3444988 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 10 | 47180 | 47467 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 11 | 609738 | 610025 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 12 | 438888 | 439178 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 13 | 74027 | 74317 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022571.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00580.23 | 0.75 | 9 | 2630 | same-strand | UvrD/REP helicase N-terminal domain |
| 2 | PF13361.8 | 0.75 | 9 | 2630 | same-strand | UvrD-like helicase C-terminal domain |
| 3 | PF13245.8 | 0.75 | 9 | 2630 | same-strand | AAA domain |
| 4 | PF13538.8 | 0.75 | 9 | 2630 | same-strand | UvrD-like helicase C-terminal domain |
| 5 | PF01653.20 | 0.75 | 9 | 588 | same-strand | NAD-dependent DNA ligase adenylation domain |
| 6 | PF03120.18 | 0.75 | 9 | 588 | same-strand | NAD-dependent DNA ligase OB-fold domain |
| 7 | PF12826.9 | 0.75 | 9 | 588 | same-strand | Helix-hairpin-helix motif |
| 8 | PF00533.28 | 0.75 | 9 | 588 | same-strand | BRCA1 C Terminus (BRCT) domain |
| 9 | PF14520.8 | 0.75 | 9 | 588 | same-strand | Helix-hairpin-helix domain |
| 10 | PF12738.9 | 0.75 | 9 | 588 | same-strand | twin BRCT domain |
| 11 | PF00633.25 | 0.67 | 8 | 567.5 | same-strand | Helix-hairpin-helix motif |
| 12 | PF01425.23 | 0.83 | 10 | 27 | same-strand | Amidase |
| 13 | PF02934.17 | 0.83 | 10 | 1526 | same-strand | GatB/GatE catalytic domain |
| 14 | PF02637.20 | 0.83 | 10 | 1526 | same-strand | GatB domain |
++ More..