Result : EXP01691
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01691 |
| NCBI Accession ID | NC_003210.1 |
| Organism | Listeria monocytogenes strain EGD |
| Left | 271042 |
| Right | 271158 |
| Strand | + |
| Nucleotide Sequence | ATGCTTAGAATGAAAGATATACTAGAAAAAAACAACCAATCAAGACAGAAGATAATAGGTATTTCTTTAACGTTCCTGCATAGCTCACCGGTGTCTTTTCAAGGTAGCGTCCGTTAA |
| Sequence | MLRMKDILEKNNQSRQKIIGISLTFLHSSPVSFQGSVR |
| Source of smORF | Literature |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 271042 | 271158 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 2 | 315245 | 315361 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 3 | 226699 | 226815 | + | NZ_LT906444.1 | Listeria welshimeri |
| 4 | 255625 | 255741 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 5 | 5093238 | 5093345 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003210.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03965.18 | 0.6 | 3 | 3121 | same-strand | Penicillinase repressor |
| 2 | PF05569.13 | 0.6 | 3 | 2067 | same-strand | BlaR1 peptidase M56 |
| 3 | PF06998.13 | 0.6 | 3 | 785 | same-strand | Protein of unknown function (DUF1307) |
| 4 | PF05175.16 | 0.8 | 4 | 65.0 | same-strand | Methyltransferase small domain |
| 5 | PF13649.8 | 0.8 | 4 | 65.0 | same-strand | Methyltransferase domain |
| 6 | PF08242.14 | 0.8 | 4 | 65.0 | same-strand | Methyltransferase domain |
++ More..