Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01691 |
NCBI Accession ID | NC_003210.1 |
Organism | Listeria monocytogenes strain EGD |
Left | 271042 |
Right | 271158 |
Strand | + |
Nucleotide Sequence | ATGCTTAGAATGAAAGATATACTAGAAAAAAACAACCAATCAAGACAGAAGATAATAGGTATTTCTTTAACGTTCCTGCATAGCTCACCGGTGTCTTTTCAAGGTAGCGTCCGTTAA |
Sequence | MLRMKDILEKNNQSRQKIIGISLTFLHSSPVSFQGSVR |
Source of smORF | Literature |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 38 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 271042 | 271158 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
2 | 315245 | 315361 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
3 | 226699 | 226815 | + | NZ_LT906444.1 | Listeria welshimeri |
4 | 255625 | 255741 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
5 | 5093238 | 5093345 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03965.18 | 0.6 | 3 | 3121 | same-strand | Penicillinase repressor |
2 | PF05569.13 | 0.6 | 3 | 2067 | same-strand | BlaR1 peptidase M56 |
3 | PF06998.13 | 0.6 | 3 | 785 | same-strand | Protein of unknown function (DUF1307) |
4 | PF05175.16 | 0.8 | 4 | 65.0 | same-strand | Methyltransferase small domain |
5 | PF13649.8 | 0.8 | 4 | 65.0 | same-strand | Methyltransferase domain |
6 | PF08242.14 | 0.8 | 4 | 65.0 | same-strand | Methyltransferase domain |