Result : EXP01689
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01689 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 545107 |
| Right | 545364 |
| Strand | - |
| Nucleotide Sequence | TTGTTAAGCAATGATTTTAAGCTATGGAAAAGAGGTGATAGCAGTATGCCAGGGATTAAGGTTAGAGAAGGCGATGCGTTTGATGAAGCTTACAGGAGATTCAAAAAGCAAACCGATCGCAATCTAGTGGTAACAGAATGCCGTGCTAGAAGGTTCTTTGAGTCTAGAACTGAAAAACGCAAAAAACAAAAAATCAGCGCTAAAAAGAAGGTCTTAAAGCGTCTTTACATGTTAAGGCGTTATGAATCAAGACTATAA |
| Sequence | LLSNDFKLWKRGDSSMPGIKVREGDAFDEAYRRFKKQTDRNLVVTECRARRFFESRTEKRKKQKISAKKKVLKRLYMLRRYESRL |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];ribosome [GO:0005840];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | 30796087 |
| Domain | CDD:412427 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q1CTW4 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 552227 | 552481 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 665702 | 665914 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 3 | 1363358 | 1363570 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 4 | 617366 | 617578 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 5 | 745877 | 746089 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 6 | 139208 | 139420 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 7 | 137047 | 137259 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 8 | 104678 | 104890 | + | NZ_CP059443.1 | Campylobacter fetus |
| 9 | 130727 | 130939 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 10 | 136717 | 136929 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 11 | 2711363 | 2711575 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 12 | 3047602 | 3047814 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 13 | 1507691 | 1507903 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 14 | 2645000 | 2645212 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 15 | 375359 | 375571 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 16 | 294659 | 294871 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 17 | 897676 | 897888 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 18 | 339071 | 339283 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 19 | 231804 | 232016 | - | NZ_CP012541.1 | Campylobacter concisus |
| 20 | 2807188 | 2807400 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 21 | 149452 | 149664 | + | NZ_CP012544.1 | Campylobacter showae |
| 22 | 2396836 | 2397048 | - | NZ_CP012543.1 | Campylobacter rectus |
| 23 | 2926115 | 2926327 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 24 | 1616141 | 1616353 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 25 | 2594779 | 2594991 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 26 | 1482304 | 1482516 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 27 | 2737169 | 2737381 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 28 | 2565053 | 2565265 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 29 | 2752949 | 2753161 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 30 | 117006 | 117218 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 31 | 1434729 | 1434941 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 32 | 1499565 | 1499777 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 33 | 1508107 | 1508319 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 34 | 1621641 | 1621853 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 35 | 1624254 | 1624466 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 36 | 619565 | 619777 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 37 | 1047463 | 1047675 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 38 | 1832124 | 1832336 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 39 | 170904 | 171116 | - | NZ_CP053826.1 | Campylobacter curvus |
| 40 | 85315 | 85527 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 41 | 111732 | 111944 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 42 | 165249 | 165461 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 43 | 139817 | 140029 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 44 | 3060186 | 3060398 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 45 | 2913706 | 2913918 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 46 | 93337 | 93549 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 47 | 2541627 | 2541839 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 48 | 2539295 | 2539507 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 49 | 2918732 | 2918944 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 50 | 95929 | 96141 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 51 | 1905309 | 1905521 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 52 | 2439726 | 2439938 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 53 | 90422 | 90634 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 54 | 145680 | 145892 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 55 | 2779794 | 2780006 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 56 | 2811513 | 2811725 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 57 | 2854155 | 2854367 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 58 | 478172 | 478384 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 59 | 69496 | 69708 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 60 | 61492 | 61704 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 61 | 1754995 | 1755207 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 62 | 392572 | 392784 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 63 | 304635 | 304847 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 64 | 145476 | 145688 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 65 | 2164932 | 2165144 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 66 | 319845 | 320057 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 67 | 1619812 | 1620024 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 68 | 1735545 | 1735757 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 69 | 59017 | 59229 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 70 | 106072 | 106284 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 71 | 19500 | 19712 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 72 | 17541 | 17753 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 73 | 27313 | 27525 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 74 | 1312697 | 1312909 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 75 | 753513 | 753725 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 76 | 76618 | 76830 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 77 | 229298 | 229510 | - | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 78 | 3080336 | 3080548 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 79 | 285810 | 286022 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 80 | 218984 | 219196 | - | NC_012115.1 | Nautilia profundicola AmH |
| 81 | 269004 | 269216 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 82 | 2028533 | 2028745 | + | NZ_CP063164.1 | Sulfurovum indicum |
++ More..