Result : EXP01681
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01681 |
| NCBI Accession ID | NC_000964.3 |
| Organism | Bacillus subtilus 168 |
| Left | 1071354 |
| Right | 1071488 |
| Strand | + |
| Nucleotide Sequence | TTGCTGATGACATACTTATATATTGATCAAGAAAAGGAGGTATGTAACATGAGCGGAGGATACTCTAACGGATTCGCGTTGCTCGTAGTACTGTTCATTTTGCTTATCATCGTAGGTGCAGCTTACATCTACTAA |
| Sequence | LLMTYLYIDQEKEVCNMSGGYSNGFALLVVLFILLIIVGAAYIY |
| Source of smORF | Literature |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1071354 | 1071488 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 430185 | 430307 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1055649 | 1055783 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1003698 | 1003832 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1044014 | 1044148 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 921052 | 921180 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1075203 | 1075331 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1251639 | 1251773 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 9 | 1145111 | 1145242 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 10 | 890442 | 890570 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 11 | 2023260 | 2023385 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 12 | 2215760 | 2215897 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 13 | 1764277 | 1764417 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 14 | 1182210 | 1182338 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 15 | 3532724 | 3532852 | + | NZ_CP011937.1 | Bacillus velezensis |
| 16 | 421204 | 421332 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00149.30 | 0.6 | 9 | 5282 | same-strand | Calcineurin-like phosphoesterase |
| 2 | PF12850.9 | 0.6 | 9 | 5282 | same-strand | Calcineurin-like phosphoesterase superfamily domain |
| 3 | PF13514.8 | 0.6 | 9 | 2382 | same-strand | AAA domain |
| 4 | PF01966.24 | 0.67 | 10 | 1364.5 | same-strand | HD domain |
| 5 | PF13616.8 | 0.6 | 9 | 112 | opposite-strand | PPIC-type PPIASE domain |
| 6 | PF00639.23 | 0.6 | 9 | 112 | opposite-strand | PPIC-type PPIASE domain |
| 7 | PF13145.8 | 0.6 | 9 | 112 | opposite-strand | PPIC-type PPIASE domain |
| 8 | PF11667.10 | 0.6 | 9 | 554 | opposite-strand | Putative zincin peptidase |
| 9 | PF01047.24 | 0.6 | 9 | 1618 | opposite-strand | MarR family |
| 10 | PF13463.8 | 0.6 | 9 | 1618 | opposite-strand | Winged helix DNA-binding domain |
| 11 | PF12732.9 | 0.6 | 9 | 2407 | opposite-strand | YtxH-like protein |
++ More..