Result : EXP01675
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01675 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1139054 |
| Right | 1139227 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTACCAAAAAGAAGAACTTCTAAAACTAGAAAAAACAAACGTCGTACGCATTTCAAAATTTCAGTACCAGGTATGACTGAATGCCCAAACTGTGGCGAATACAAATTATCACACCGTGTATGTAAAAACTGTGGTTCTTACAATGGCGAAGAAGTAGCAGCTAAATAA |
| Sequence | MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];large ribosomal subunit [GO:0015934];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:415589 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q7MT50 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 722
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1112459 | 1112632 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 2 | 190854 | 191027 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 3 | 1618210 | 1618383 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 4 | 1759050 | 1759223 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 5 | 1178578 | 1178751 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 6 | 433997 | 434170 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 7 | 797674 | 797847 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 8 | 1725429 | 1725602 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 9 | 651573 | 651746 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 10 | 1091134 | 1091307 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 11 | 1696022 | 1696195 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 12 | 2284769 | 2284942 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 13 | 1879593 | 1879766 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 14 | 1028027 | 1028200 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 15 | 930365 | 930538 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 16 | 1810950 | 1811123 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 17 | 1718848 | 1719021 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 18 | 1889422 | 1889595 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 19 | 1554843 | 1555013 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 20 | 99725 | 99898 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 21 | 1598936 | 1599109 | + | NZ_CP027770.1 | Staphylococcus felis |
| 22 | 2085910 | 2086083 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 23 | 878822 | 878995 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 24 | 725284 | 725457 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 25 | 1788692 | 1788865 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 26 | 743797 | 743970 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 27 | 1079139 | 1079312 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 28 | 1678088 | 1678261 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 29 | 1039243 | 1039416 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 30 | 1343599 | 1343772 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 31 | 804911 | 805084 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 32 | 913722 | 913895 | + | NZ_CP047361.1 | Macrococcus canis |
| 33 | 985836 | 986009 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 34 | 1570520 | 1570693 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 35 | 2434069 | 2434242 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 36 | 2183816 | 2183989 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 37 | 587760 | 587933 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 38 | 1931525 | 1931698 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 39 | 3419714 | 3419890 | + | NZ_CP021434.1 | Tumebacillus avium |
| 40 | 1658346 | 1658519 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 41 | 3948807 | 3948980 | - | NC_011725.1 | Bacillus cereus B4264 |
| 42 | 2660163 | 2660336 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 43 | 1269370 | 1269543 | + | NZ_CP012024.1 | Bacillus smithii |
| 44 | 3814293 | 3814466 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 45 | 1567394 | 1567567 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 46 | 1289509 | 1289682 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 47 | 406708 | 406887 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 48 | 937743 | 937916 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 49 | 3732798 | 3732971 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 50 | 3302786 | 3302959 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 51 | 1466409 | 1466582 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 52 | 3848721 | 3848894 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 53 | 3955403 | 3955576 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 54 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 55 | 1661277 | 1661450 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 56 | 2873238 | 2873411 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 57 | 1709708 | 1709881 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 58 | 1414933 | 1415106 | + | NZ_CP040336.1 | Bacillus luti |
| 59 | 3744933 | 3745106 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 60 | 2855137 | 2855310 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 61 | 569247 | 569420 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 62 | 1322379 | 1322555 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 63 | 220255 | 220428 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 64 | 1124474 | 1124647 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 65 | 2242608 | 2242781 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 66 | 2754307 | 2754480 | - | NZ_LS483476.1 | Lederbergia lentus |
| 67 | 1411660 | 1411833 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 68 | 2429204 | 2429383 | - | NZ_CP011937.1 | Bacillus velezensis |
| 69 | 1754154 | 1754333 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 70 | 1483213 | 1483392 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 71 | 1531760 | 1531939 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 72 | 1579870 | 1580049 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 73 | 1542331 | 1542510 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 74 | 1548657 | 1548836 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 75 | 410195 | 410374 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 76 | 1575804 | 1575983 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 77 | 2669166 | 2669339 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 78 | 243753 | 243926 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 79 | 822488 | 822661 | + | NZ_LR134483.1 | Listeria grayi |
| 80 | 1679672 | 1679845 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 81 | 1702316 | 1702489 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 82 | 2058901 | 2059074 | + | NZ_CP053989.1 | Niallia circulans |
| 83 | 538130 | 538309 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 84 | 2474162 | 2474335 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 85 | 524702 | 524875 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 86 | 2707246 | 2707419 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 87 | 3370820 | 3370993 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 88 | 1343755 | 1343928 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 89 | 4077467 | 4077640 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 90 | 1346892 | 1347065 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 91 | 1972044 | 1972217 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 92 | 2185942 | 2186118 | - | NZ_CP016540.2 | Planococcus versutus |
| 93 | 2171747 | 2171923 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 94 | 2276097 | 2276273 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 95 | 2942780 | 2942956 | + | NZ_CP013661.2 | Planococcus kocurii |
| 96 | 2320740 | 2320916 | - | NZ_CP019401.1 | Planococcus faecalis |
| 97 | 2462749 | 2462925 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 98 | 2023882 | 2024058 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 99 | 2046440 | 2046616 | - | NZ_CP016538.2 | Planococcus maritimus |
| 100 | 2069690 | 2069866 | - | NZ_CP059540.1 | Planococcus maritimus |
| 101 | 1842410 | 1842586 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 102 | 2660917 | 2661090 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 103 | 1700206 | 1700379 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 104 | 5057461 | 5057634 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 105 | 2068362 | 2068535 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 106 | 1027570 | 1027749 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 107 | 2946506 | 2946682 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 108 | 3488121 | 3488294 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 109 | 430308 | 430487 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 110 | 441333 | 441512 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 111 | 1038074 | 1038253 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 112 | 1239944 | 1240135 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 113 | 1633326 | 1633517 | - | NZ_CP014159.1 | Aerococcus christensenii |
| 114 | 2588071 | 2588244 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 115 | 1591605 | 1591787 | - | NZ_CP034118.1 | Staphylospora marina |
| 116 | 1961854 | 1962027 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 117 | 4827568 | 4827741 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 118 | 861213 | 861389 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 119 | 1812295 | 1812474 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 120 | 2952919 | 2953092 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 121 | 2164210 | 2164389 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 122 | 957618 | 957791 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 123 | 4133809 | 4133982 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 124 | 1046423 | 1046596 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 125 | 3489690 | 3489863 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 126 | 1054381 | 1054554 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 127 | 5444947 | 5445120 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 128 | 3286658 | 3286831 | + | NZ_CP034437.1 | Paenibacillus albus |
| 129 | 3571920 | 3572093 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 130 | 2315011 | 2315190 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 131 | 912440 | 912613 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 132 | 714458 | 714634 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 133 | 2750372 | 2750545 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 134 | 457946 | 458116 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 135 | 1202959 | 1203141 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 136 | 6090049 | 6090222 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 137 | 4637492 | 4637665 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 138 | 2471199 | 2471372 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 139 | 1483640 | 1483825 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 140 | 707068 | 707253 | + | NZ_CP014164.1 | Aerococcus viridans |
| 141 | 3506843 | 3507016 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 142 | 1406103 | 1406282 | + | NZ_CP014163.1 | Aerococcus urinaehominis |
| 143 | 2820684 | 2820857 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 144 | 4355197 | 4355370 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 145 | 3825035 | 3825208 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 146 | 2799146 | 2799319 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 147 | 6400738 | 6400911 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 148 | 1869348 | 1869521 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 149 | 2620886 | 2621059 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 150 | 4003695 | 4003868 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 151 | 630431 | 630619 | + | NZ_CP014161.1 | Aerococcus urinae |
| 152 | 2580181 | 2580351 | + | NZ_CP026363.1 | Brevibacillus agri |
| 153 | 2370650 | 2370820 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 154 | 4553645 | 4553818 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 155 | 1226710 | 1226883 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 156 | 1947656 | 1947835 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 157 | 6132588 | 6132761 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 158 | 2098096 | 2098269 | - | NZ_LT906444.1 | Listeria welshimeri |
| 159 | 1012418 | 1012591 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 160 | 4085269 | 4085442 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 161 | 225187 | 225360 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 162 | 1474082 | 1474255 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 163 | 58177 | 58350 | - | NZ_CP043404.1 | Bacillus safensis |
| 164 | 2539668 | 2539841 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 165 | 1526838 | 1527011 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 166 | 2608753 | 2608926 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 167 | 3024857 | 3025030 | + | NZ_CP009288.1 | Paenibacillus durus |
| 168 | 3026616 | 3026789 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 169 | 5261909 | 5262082 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 170 | 3355085 | 3355258 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 171 | 5260224 | 5260397 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 172 | 3732024 | 3732197 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 173 | 3847434 | 3847607 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 174 | 785250 | 785423 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 175 | 1731515 | 1731694 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 176 | 2609470 | 2609643 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 177 | 2088361 | 2088534 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 178 | 422948 | 423118 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 179 | 2190971 | 2191144 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 180 | 483279 | 483449 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 181 | 2130228 | 2130401 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 182 | 2776749 | 2776922 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 183 | 570419 | 570598 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 184 | 1140408 | 1140590 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 185 | 621077 | 621259 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 186 | 1312498 | 1312677 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 187 | 1821893 | 1822072 | - | NZ_CP065211.1 | Enterococcus lactis |
| 188 | 811634 | 811813 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 189 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 190 | 2125539 | 2125712 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 191 | 1556094 | 1556270 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 192 | 1052505 | 1052684 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 193 | 2505426 | 2505605 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 194 | 1579599 | 1579781 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 195 | 286215 | 286391 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 196 | 42176 | 42349 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 197 | 2508014 | 2508187 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 198 | 1588058 | 1588231 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 199 | 1694794 | 1694976 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 200 | 908675 | 908854 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 201 | 1040970 | 1041143 | + | NZ_CP033433.1 | Cohnella candidum |
| 202 | 4336941 | 4337114 | - | NZ_AP019400.1 | Cohnella abietis |
| 203 | 2411937 | 2412116 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 204 | 1117535 | 1117717 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 205 | 750013 | 750195 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 206 | 824255 | 824437 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 207 | 691333 | 691515 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 208 | 2548213 | 2548392 | - | NZ_CP023011.2 | Enterococcus hirae |
| 209 | 1494765 | 1494938 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 210 | 1927486 | 1927653 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 211 | 1748652 | 1748819 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 212 | 971305 | 971484 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 213 | 1784177 | 1784356 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 214 | 1709678 | 1709851 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 215 | 2224137 | 2224310 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 216 | 672019 | 672201 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 217 | 3997549 | 3997722 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 218 | 2177879 | 2178052 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 219 | 790930 | 791106 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 220 | 1094202 | 1094369 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 221 | 1147125 | 1147304 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 222 | 551462 | 551638 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 223 | 926536 | 926715 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 224 | 2682283 | 2682459 | - | NC_014624.2 | Eubacterium callanderi |
| 225 | 4290647 | 4290823 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 226 | 3094175 | 3094351 | + | NZ_CP019962.1 | Eubacterium limosum |
| 227 | 1135739 | 1135918 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 228 | 1206918 | 1207097 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 229 | 1829739 | 1829921 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 230 | 944850 | 945026 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 231 | 1901972 | 1902148 | + | NZ_CP036259.1 | Sporomusa termitida |
| 232 | 813582 | 813761 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 233 | 3362575 | 3362748 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 234 | 2709716 | 2709889 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 235 | 1473534 | 1473707 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 236 | 1257525 | 1257704 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 237 | 1009182 | 1009361 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 238 | 1619826 | 1620005 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 239 | 2189694 | 2189885 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 240 | 4250446 | 4250622 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 241 | 1318504 | 1318683 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 242 | 1453976 | 1454152 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 243 | 2429174 | 2429353 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 244 | 1497414 | 1497596 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 245 | 1414305 | 1414487 | - | NC_008593.1 | Clostridium novyi NT |
| 246 | 5381 | 5569 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 247 | 1044416 | 1044598 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 248 | 695115 | 695303 | + | NZ_CP029256.1 | Christensenella minuta |
| 249 | 994189 | 994368 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 250 | 1951888 | 1952067 | - | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 251 | 1804192 | 1804368 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 252 | 1219651 | 1219836 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 253 | 1300986 | 1301162 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 254 | 1776610 | 1776798 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 255 | 1310958 | 1311131 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 256 | 1184474 | 1184647 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 257 | 1513040 | 1513213 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 258 | 1856055 | 1856228 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 259 | 1204701 | 1204889 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 260 | 1599842 | 1600015 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 261 | 1153792 | 1153971 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 262 | 3720902 | 3721084 | - | NZ_CP061799.1 | Desulfonema limicola |
| 263 | 31740 | 31922 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 264 | 1644357 | 1644530 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 265 | 786562 | 786738 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 266 | 1052967 | 1053140 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 267 | 1817447 | 1817629 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 268 | 2971550 | 2971729 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 269 | 2934799 | 2934987 | + | NC_017448.1 | Fibrobacter succinogenes subsp. succinogenes S85 |
| 270 | 1427744 | 1427917 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 271 | 709464 | 709649 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 272 | 1061168 | 1061371 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 273 | 875448 | 875651 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 274 | 2298754 | 2298957 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 275 | 1894745 | 1894927 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 276 | 572043 | 572213 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 277 | 1269641 | 1269823 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 278 | 875114 | 875293 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 279 | 1364049 | 1364225 | - | NZ_LR778174.1 | Veillonella parvula |
| 280 | 1681429 | 1681605 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 281 | 1252230 | 1252406 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 282 | 1305974 | 1306150 | - | NZ_LR134375.1 | Veillonella dispar |
| 283 | 2088631 | 2088816 | - | NZ_HG917868.1 | Clostridium bornimense |
| 284 | 2001719 | 2001904 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 285 | 1900192 | 1900371 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 286 | 136577 | 136759 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 287 | 3092726 | 3092908 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 288 | 2641561 | 2641740 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 289 | 2870716 | 2870895 | + | NC_018178.1 | Melioribacter roseus P3M-2 |
| 290 | 1833992 | 1834174 | + | NZ_CP040924.1 | Clostridium thermarum |
| 291 | 938269 | 938448 | + | NZ_CP041659.1 | Sphingomonas xanthus |
| 292 | 1542477 | 1542656 | - | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 293 | 2285039 | 2285215 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 294 | 1175304 | 1175486 | + | NZ_CP020953.1 | Clostridium drakei |
| 295 | 1216211 | 1216414 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 296 | 1393664 | 1393840 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 297 | 2544446 | 2544625 | - | NZ_CP060717.1 | Sphingomonas rhizophila |
| 298 | 4796897 | 4797082 | + | NZ_CP030265.1 | Skermanella pratensis |
| 299 | 2840264 | 2840440 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 300 | 1176785 | 1176970 | - | NZ_CP016786.1 | Clostridium isatidis |
| 301 | 575049 | 575228 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 302 | 4600859 | 4601038 | - | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 303 | 837141 | 837320 | + | NZ_CP060780.1 | Sphingomonas daechungensis |
| 304 | 5366660 | 5366839 | + | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 305 | 2537671 | 2537853 | - | NZ_CP028842.1 | Clostridium botulinum |
| 306 | 2800041 | 2800223 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 307 | 1483349 | 1483537 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 308 | 1360416 | 1360607 | - | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 309 | 797570 | 797746 | + | NZ_LT906470.1 | Veillonella rodentium |
| 310 | 787142 | 787321 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 311 | 72063 | 72242 | + | NZ_CP060782.1 | Sphingomonas sediminicola |
| 312 | 1548425 | 1548607 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 313 | 1266883 | 1267068 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 314 | 197948 | 198133 | - | NZ_CP023671.1 | Clostridium septicum |
| 315 | 1950491 | 1950670 | - | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
| 316 | 1804594 | 1804776 | + | NZ_CP048649.1 | Aminipila butyrica |
| 317 | 1182796 | 1182978 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 318 | 1563555 | 1563737 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 319 | 2904453 | 2904632 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 320 | 7257131 | 7257313 | - | NZ_CP061800.1 | Desulfonema magnum |
| 321 | 2190921 | 2191100 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 322 | 3382287 | 3382469 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 323 | 3915249 | 3915428 | + | NC_009511.1 | Sphingomonas wittichii RW1 |
| 324 | 2557118 | 2557300 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 325 | 1043854 | 1044036 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 326 | 182741 | 182935 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 327 | 2175466 | 2175648 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 328 | 1495256 | 1495453 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 329 | 89918 | 90097 | + | NZ_CP042306.1 | Sphingomonas panacisoli |
| 330 | 1372908 | 1373087 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 331 | 768359 | 768547 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 332 | 617435 | 617614 | - | NZ_CP060718.1 | Sphingomonas lutea |
| 333 | 1560686 | 1560877 | + | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 334 | 5672539 | 5672721 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 335 | 1421752 | 1421934 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 336 | 1498647 | 1498829 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 337 | 150096 | 150278 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 338 | 1136158 | 1136340 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 339 | 1498932 | 1499114 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 340 | 4111825 | 4112007 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 341 | 1136666 | 1136842 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 342 | 707314 | 707490 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 343 | 1498608 | 1498784 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 344 | 1295284 | 1295460 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 345 | 1614739 | 1614915 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 346 | 1349830 | 1350006 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 347 | 1150888 | 1151070 | + | NZ_CP030775.1 | Clostridium butyricum |
| 348 | 1504173 | 1504355 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 349 | 2286089 | 2286268 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 350 | 1437153 | 1437335 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 351 | 2873184 | 2873366 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 352 | 2393360 | 2393542 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 353 | 1775742 | 1775924 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 354 | 1698609 | 1698791 | - | NZ_CP014204.2 | Clostridium baratii |
| 355 | 402507 | 402686 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 356 | 1670019 | 1670201 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 357 | 2269010 | 2269198 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 358 | 2777768 | 2777947 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 359 | 1741032 | 1741214 | + | NZ_CP014525.1 | Haematospirillum jordaniae |
| 360 | 896379 | 896558 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 361 | 1385259 | 1385441 | + | NZ_CP043998.1 | Clostridium diolis |
| 362 | 1560680 | 1560862 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 363 | 1023814 | 1024002 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 364 | 1646701 | 1646886 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 365 | 2065775 | 2065960 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 366 | 3952769 | 3952957 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 367 | 2406616 | 2406798 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 368 | 1353164 | 1353367 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 369 | 1956259 | 1956444 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 370 | 588105 | 588284 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 371 | 2422914 | 2423093 | + | NZ_CP023705.1 | Sphingomonas melonis |
| 372 | 1424987 | 1425175 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 373 | 890727 | 890909 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 374 | 2503337 | 2503513 | + | NZ_CP020083.1 | Blastomonas fulva |
| 375 | 374293 | 374442 | - | NC_012115.1 | Nautilia profundicola AmH |
| 376 | 1751670 | 1751852 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 377 | 1473583 | 1473762 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 378 | 2049283 | 2049465 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 379 | 245826 | 246008 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 380 | 964064 | 964240 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 381 | 2226730 | 2226912 | + | NZ_AP019700.1 | Stella humosa |
| 382 | 1418001 | 1418177 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 383 | 3105720 | 3105902 | - | NZ_CP014176.1 | Clostridium argentinense |
| 384 | 949528 | 949707 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 385 | 2214919 | 2215101 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 386 | 2535783 | 2535959 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 387 | 318117 | 318296 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 388 | 1601762 | 1601941 | - | NZ_CP053015.1 | Sphingomonas lacunae |
| 389 | 1704635 | 1704817 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 390 | 1387710 | 1387889 | + | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 391 | 3052309 | 3052488 | - | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 392 | 3615195 | 3615380 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 393 | 1379139 | 1379324 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 394 | 128608 | 128811 | - | NZ_CP038141.1 | Swingsia samuiensis |
| 395 | 1798827 | 1799009 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 396 | 2112666 | 2112848 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 397 | 47802 | 47978 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 398 | 32541 | 32723 | + | NZ_HF545617.1 | Ruminococcus bicirculans |
| 399 | 2501011 | 2501193 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 400 | 2092662 | 2092847 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 401 | 1208599 | 1208778 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 402 | 969534 | 969737 | + | NZ_CP014681.1 | Kozakia baliensis |
| 403 | 1519180 | 1519329 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 404 | 1243941 | 1244126 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 405 | 2123065 | 2123253 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 406 | 2021358 | 2021546 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 407 | 1574868 | 1575050 | - | NZ_CP030126.1 | Indioceanicola profundi |
| 408 | 1206868 | 1207050 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 409 | 2100356 | 2100535 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 410 | 2910463 | 2910642 | - | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 411 | 1177006 | 1177209 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 412 | 1333899 | 1334081 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 413 | 1312099 | 1312281 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 414 | 2232636 | 2232818 | + | NZ_CP042906.1 | Hypericibacter terrae |
| 415 | 1742962 | 1743165 | - | NZ_CP042808.1 | Acetobacter oryzoeni |
| 416 | 641168 | 641371 | - | NC_021991.1 | Acetobacter pasteurianus 386B |
| 417 | 1395646 | 1395849 | - | NZ_CP015164.1 | Acetobacter ascendens |
| 418 | 1965937 | 1966140 | - | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 419 | 3717708 | 3717887 | + | NZ_AP017655.1 | Sphingobium cloacae |
| 420 | 1512956 | 1513132 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 421 | 3693381 | 3693566 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 422 | 5370848 | 5371042 | - | NZ_CP036273.1 | Urbifossiella limnaea |
| 423 | 2515516 | 2515695 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 424 | 3849881 | 3850060 | - | NZ_CP009571.1 | Sphingomonas taxi |
| 425 | 133703 | 133906 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 426 | 1435564 | 1435746 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 427 | 1332474 | 1332647 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 428 | 2516040 | 2516219 | - | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 429 | 3302240 | 3302419 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 430 | 1343520 | 1343708 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 431 | 1184675 | 1184857 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 432 | 389608 | 389793 | + | NZ_CP013195.1 | Prevotella enoeca |
| 433 | 1462250 | 1462426 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 434 | 2144629 | 2144808 | - | NZ_LR699011.1 | Roseburia hominis |
| 435 | 705122 | 705310 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 436 | 922348 | 922533 | - | NZ_CP024727.1 | Prevotella intermedia |
| 437 | 1500211 | 1500396 | - | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 438 | 198640 | 198825 | + | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 439 | 1951136 | 1951315 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 440 | 3218329 | 3218508 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 441 | 1647166 | 1647345 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 442 | 384396 | 384545 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 443 | 1873945 | 1874130 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 444 | 2915979 | 2916164 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 445 | 3020453 | 3020635 | - | NZ_CP042582.1 | Hypericibacter adhaerens |
| 446 | 2279729 | 2279911 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 447 | 1367078 | 1367257 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 448 | 752159 | 752338 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 449 | 2979542 | 2979745 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 450 | 2948786 | 2948965 | - | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 451 | 2222042 | 2222224 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 452 | 1043147 | 1043323 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 453 | 684832 | 685008 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 454 | 712718 | 712894 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 455 | 825447 | 825623 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 456 | 1747075 | 1747260 | - | NZ_CP023863.1 | Prevotella jejuni |
| 457 | 1836028 | 1836207 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 458 | 82935 | 83120 | + | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 459 | 875628 | 875798 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 460 | 3375831 | 3376034 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 461 | 277244 | 277429 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 462 | 4376911 | 4377090 | + | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 463 | 4998737 | 4998922 | - | NZ_CP055156.1 | Adhaeribacter swui |
| 464 | 1785592 | 1785777 | - | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 465 | 37539 | 37718 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 466 | 2861270 | 2861449 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 467 | 1402720 | 1402905 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 468 | 2497257 | 2497442 | + | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 469 | 3495914 | 3496099 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 470 | 3085985 | 3086170 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 471 | 643008 | 643193 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 472 | 4576322 | 4576507 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 473 | 691649 | 691834 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 474 | 2290765 | 2290950 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 475 | 621593 | 621772 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 476 | 1958454 | 1958639 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 477 | 135892 | 136074 | + | NZ_CP070062.1 | Coprococcus comes |
| 478 | 1173982 | 1174164 | + | NZ_CP017057.1 | Erythrobacter litoralis |
| 479 | 1323746 | 1323928 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 480 | 82873 | 83049 | - | NZ_CP016033.1 | Erythrobacter neustonensis |
| 481 | 1275152 | 1275334 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 482 | 699778 | 699957 | - | NZ_CP022745.1 | Sphingobium xenophagum |
| 483 | 819364 | 819549 | + | NZ_CP042806.1 | Terriglobus albidus |
| 484 | 2441976 | 2442158 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 485 | 2412407 | 2412592 | + | NZ_CP039126.1 | Blautia producta |
| 486 | 239050 | 239232 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 487 | 1325807 | 1325986 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 488 | 344230 | 344433 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 489 | 313848 | 314033 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 490 | 5133168 | 5133353 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 491 | 1471418 | 1471594 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 492 | 1968030 | 1968206 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 493 | 3548709 | 3548894 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 494 | 1586935 | 1587129 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 495 | 1189974 | 1190156 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 496 | 1241516 | 1241692 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 497 | 3612851 | 3613042 | + | NC_014033.1 | Prevotella ruminicola 23 |
| 498 | 2763060 | 2763239 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 499 | 3597790 | 3597972 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 500 | 790989 | 791171 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 501 | 456012 | 456191 | - | NC_006055.1 | Mesoplasma florum L1 |
| 502 | 503440 | 503619 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
| 503 | 512482 | 512661 | - | NZ_CP024969.1 | Mesoplasma tabanidae |
| 504 | 472750 | 472929 | - | NZ_CP024411.1 | Mesoplasma entomophilum |
| 505 | 501574 | 501753 | - | NZ_CP023173.1 | Mesoplasma chauliocola |
| 506 | 1977511 | 1977708 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 507 | 589671 | 589844 | - | NZ_CP024962.1 | Entomoplasma freundtii |
| 508 | 1959631 | 1959828 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 509 | 1555259 | 1555438 | - | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 510 | 75057 | 75236 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 511 | 688870 | 689049 | - | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 512 | 575490 | 575675 | - | NZ_LR027382.1 | Alistipes megaguti |
| 513 | 920906 | 921082 | - | NZ_CP012622.1 | Spiroplasma cantharicola |
| 514 | 523933 | 524115 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 515 | 669833 | 670009 | - | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 516 | 705939 | 706115 | - | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 517 | 897061 | 897237 | - | NC_022998.1 | Spiroplasma apis B31 |
| 518 | 873994 | 874170 | - | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 519 | 965699 | 965875 | - | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 520 | 1038292 | 1038468 | - | NZ_CP043026.1 | Spiroplasma chinense |
| 521 | 408240 | 408425 | - | NZ_LR134384.1 | Prevotella oris |
| 522 | 1018288 | 1018467 | + | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 523 | 751590 | 751793 | - | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 524 | 1714420 | 1714614 | + | NZ_AP014924.1 | Limnochorda pilosa |
| 525 | 1379887 | 1380069 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 526 | 1557793 | 1557969 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 527 | 678639 | 678824 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 528 | 3302279 | 3302464 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 529 | 3182229 | 3182414 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 530 | 717763 | 717942 | - | NZ_CP031376.1 | Spiroplasma alleghenense |
| 531 | 1276465 | 1276644 | + | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 532 | 4836705 | 4836893 | + | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 533 | 478458 | 478637 | + | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 534 | 636194 | 636373 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 535 | 895185 | 895364 | - | NZ_CP022889.1 | Tsuneonella mangrovi |
| 536 | 851166 | 851348 | + | NZ_CP018799.1 | Mariprofundus aestuarium |
| 537 | 1593344 | 1593523 | - | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 538 | 887759 | 887944 | - | NZ_AP019736.1 | Alistipes dispar |
| 539 | 560442 | 560627 | + | NZ_AP019735.1 | Alistipes communis |
| 540 | 2052681 | 2052863 | - | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 541 | 5583344 | 5583529 | - | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 542 | 2459327 | 2459506 | + | NZ_CP024920.1 | Qipengyuania seohaensis |
| 543 | 1457822 | 1458007 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 544 | 2458486 | 2458671 | - | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 545 | 2447334 | 2447519 | - | NZ_CP021904.1 | Alkalitalea saponilacus |
| 546 | 299129 | 299305 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 547 | 1329320 | 1329502 | - | NZ_CP037948.1 | Qipengyuania sediminis |
| 548 | 1449538 | 1449714 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 549 | 2313017 | 2313196 | - | NZ_AP019389.1 | Qipengyuania flava |
| 550 | 2535175 | 2535354 | - | NZ_CP031357.1 | Erythrobacter aureus |
| 551 | 770235 | 770426 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 552 | 3036211 | 3036399 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 553 | 1557973 | 1558158 | - | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 554 | 2395242 | 2395424 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 555 | 362568 | 362747 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 556 | 1630966 | 1631145 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 557 | 318214 | 318393 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 558 | 972241 | 972417 | - | NZ_CP013197.1 | Spiroplasma citri |
| 559 | 270245 | 270421 | + | NZ_CP012357.1 | Spiroplasma litorale |
| 560 | 1102657 | 1102836 | + | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 561 | 1845472 | 1845651 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 562 | 3954645 | 3954833 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 563 | 1488269 | 1488454 | + | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 564 | 1127728 | 1127907 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 565 | 266975 | 267154 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 566 | 2389068 | 2389247 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 567 | 2951180 | 2951356 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 568 | 3629802 | 3629984 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 569 | 1518673 | 1518855 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 570 | 794684 | 794884 | - | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 571 | 548946 | 549122 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 572 | 806868 | 807050 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 573 | 787795 | 787977 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 574 | 789214 | 789396 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 575 | 540002 | 540184 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 576 | 1141955 | 1142140 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 577 | 2448286 | 2448468 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 578 | 10899374 | 10899562 | + | NZ_CP012333.1 | Labilithrix luteola |
| 579 | 2145973 | 2146155 | - | NZ_CP009687.1 | Clostridium aceticum |
| 580 | 3034510 | 3034689 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 581 | 266151 | 266327 | + | NZ_CP022535.1 | Spiroplasma corruscae |
| 582 | 368582 | 368758 | + | NZ_LR134484.1 | Gemella haemolysans |
| 583 | 862661 | 862861 | + | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 584 | 830473 | 830655 | + | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 585 | 1339709 | 1339894 | - | NC_022549.1 | Acholeplasma brassicae |
| 586 | 2214549 | 2214731 | - | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 587 | 262547 | 262723 | + | NZ_CP012328.1 | Spiroplasma turonicum |
| 588 | 2780422 | 2780598 | - | NZ_CP019870.1 | Clostridioides difficile |
| 589 | 553148 | 553324 | - | NZ_CP046314.1 | Gemella morbillorum |
| 590 | 756261 | 756455 | - | NZ_CP029186.1 | Flavobacterium album |
| 591 | 1169438 | 1169632 | + | NZ_CP042831.1 | Flavobacterium alkalisoli |
| 592 | 640166 | 640360 | - | NZ_CP020919.1 | Flavobacterium kingsejongi |
| 593 | 1458266 | 1458451 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 594 | 725564 | 725740 | - | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 595 | 719224 | 719400 | - | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 596 | 572040 | 572216 | + | NZ_CP024870.1 | Spiroplasma clarkii |
| 597 | 1168109 | 1168291 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 598 | 407751 | 407936 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 599 | 3354483 | 3354668 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 600 | 1816550 | 1816729 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 601 | 941297 | 941488 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 602 | 735625 | 735816 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 603 | 821241 | 821417 | - | NZ_CP017015.1 | Spiroplasma helicoides |
| 604 | 35570 | 35767 | + | NZ_CP030356.1 | Salinibacter ruber |
| 605 | 1311921 | 1312097 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 606 | 1187851 | 1188033 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 607 | 1973003 | 1973188 | + | NZ_CP015402.2 | Muribaculum intestinale |
| 608 | 745662 | 745853 | + | NZ_CP029476.1 | Lactobacillus apis |
| 609 | 1362718 | 1362906 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 610 | 1174604 | 1174786 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
| 611 | 155490 | 155690 | + | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 612 | 2377073 | 2377255 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 613 | 1475489 | 1475668 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 614 | 3019920 | 3020105 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 615 | 2960246 | 2960431 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 616 | 1770767 | 1770940 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 617 | 2033659 | 2033841 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 618 | 873630 | 873821 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 619 | 1059126 | 1059320 | + | NZ_CP031188.1 | Flavobacterium arcticum |
| 620 | 1019894 | 1020088 | - | NZ_CP029463.1 | Flavobacterium sediminis |
| 621 | 2008121 | 2008303 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 622 | 1636810 | 1636992 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 623 | 1862947 | 1863123 | - | NZ_LT906439.1 | Streptococcus merionis |
| 624 | 1299799 | 1299981 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 625 | 1402114 | 1402299 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 626 | 769572 | 769763 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 627 | 702296 | 702487 | - | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 628 | 927145 | 927333 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 629 | 258194 | 258367 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 630 | 1183277 | 1183465 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 631 | 576019 | 576219 | + | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 632 | 5263859 | 5264044 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 633 | 1284673 | 1284861 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 634 | 947673 | 947858 | + | NZ_CP049366.1 | Companilactobacillus pabuli |
| 635 | 1493078 | 1493263 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 636 | 1386963 | 1387148 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 637 | 1903206 | 1903391 | - | NC_008255.1 | Cytophaga hutchinsonii ATCC 33406 |
| 638 | 753690 | 753878 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 639 | 2129664 | 2129846 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 640 | 2334405 | 2334602 | + | NZ_CP040812.1 | Antarcticibacterium flavum |
| 641 | 868078 | 868269 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 642 | 2511330 | 2511482 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 643 | 1097253 | 1097444 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 644 | 1144645 | 1144836 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 645 | 750405 | 750596 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 646 | 2093422 | 2093604 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 647 | 2675151 | 2675348 | - | NZ_CP042476.1 | Antarcticibacterium arcticum |
| 648 | 1527754 | 1527936 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 649 | 2738900 | 2739094 | + | NC_017025.1 | Flavobacterium indicum GPTSA100-9 = DSM 17447 |
| 650 | 146572 | 146772 | + | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
| 651 | 954292 | 954474 | + | NZ_CP024610.1 | Lactobacillus terrae |
| 652 | 430844 | 431032 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 653 | 3925484 | 3925678 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 654 | 227210 | 227362 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 655 | 1831608 | 1831787 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 656 | 677526 | 677708 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 657 | 212328 | 212480 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 658 | 89669 | 89851 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 659 | 1685892 | 1686074 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 660 | 1934189 | 1934371 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 661 | 2056199 | 2056381 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 662 | 2280217 | 2280402 | - | NZ_AP018042.1 | Labilibaculum antarcticum |
| 663 | 381870 | 382052 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 664 | 1858766 | 1858954 | + | NC_023035.1 | Salinispira pacifica |
| 665 | 371238 | 371417 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 666 | 40277 | 40471 | - | NZ_CP020822.1 | Tenacibaculum maritimum |
| 667 | 1837961 | 1838143 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 668 | 476166 | 476348 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 669 | 605441 | 605623 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 670 | 1051761 | 1051943 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 671 | 270341 | 270493 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 672 | 291720 | 291872 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 673 | 257962 | 258144 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 674 | 263286 | 263468 | - | NC_012924.1 | Streptococcus suis SC84 |
| 675 | 1097301 | 1097453 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 676 | 790698 | 790880 | + | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 677 | 224674 | 224820 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 678 | 1628353 | 1628535 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 679 | 1709030 | 1709215 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 680 | 1883739 | 1883921 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 681 | 1892029 | 1892211 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 682 | 416260 | 416445 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 683 | 210715 | 210861 | + | NZ_CP059443.1 | Campylobacter fetus |
| 684 | 1498477 | 1498623 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 685 | 241503 | 241649 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 686 | 1978621 | 1978803 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 687 | 2095261 | 2095443 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 688 | 90602 | 90784 | - | NZ_LS483343.1 | Streptococcus ferus |
| 689 | 1645939 | 1646121 | - | NZ_CP013237.1 | Streptococcus mutans |
| 690 | 525080 | 525262 | + | NZ_CP043405.1 | Streptococcus ratti |
| 691 | 1342498 | 1342644 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 692 | 298317 | 298463 | - | NZ_CP012544.1 | Campylobacter showae |
| 693 | 2178294 | 2178440 | + | NZ_CP012543.1 | Campylobacter rectus |
| 694 | 660117 | 660299 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 695 | 1873578 | 1873760 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 696 | 1491361 | 1491507 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 697 | 242239 | 242397 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 698 | 582857 | 583039 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 699 | 661046 | 661228 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 700 | 1354045 | 1354191 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 701 | 1656818 | 1656967 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 702 | 1536910 | 1537062 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 703 | 1045041 | 1045220 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 704 | 2024292 | 2024471 | - | NZ_CP068114.1 | Fusobacterium canifelinum |
| 705 | 1068763 | 1068942 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 706 | 1985697 | 1985876 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 707 | 300842 | 300988 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 708 | 1247949 | 1248095 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 709 | 1286147 | 1286293 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 710 | 1283142 | 1283288 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 711 | 1403168 | 1403314 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 712 | 1578350 | 1578496 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 713 | 1621050 | 1621205 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 714 | 1244157 | 1244297 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 715 | 1405776 | 1405922 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 716 | 2184624 | 2184773 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 717 | 3156156 | 3156344 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 718 | 1425027 | 1425194 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 719 | 723354 | 723533 | + | NZ_CP009302.1 | Berryella intestinalis |
| 720 | 868472 | 868645 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 721 | 2858908 | 2859096 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 722 | 1735054 | 1735227 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 723 | 590274 | 590465 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 724 | 2149330 | 2149512 | - | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 725 | 1961856 | 1962038 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 726 | 3796690 | 3796872 | - | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134304.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.71 | 515 | 40.5 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
++ More..