Result : EXP01672
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01672 |
| NCBI Accession ID | NC_000911.1 |
| Organism | Synechocystis |
| Left | 1643502 |
| Right | 1643600 |
| Strand | - |
| Nucleotide Sequence | ATGGCCGCTGGTGTAGGCATTTTTATTGGTTATATTGCTGTTTTTACCGGGGTCACCCTTGGTCTGCTTTACGGTCTGCGGTTTGTCAAGCTGATCTAA |
| Sequence | MAAGVGIFIGYIAVFTGVTLGLLYGLRFVKLI |
| Source of smORF | Literature |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1623092 | 1623193 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 2 | 1335207 | 1335308 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 3 | 2236001 | 2236093 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014501.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00512.27 | 0.67 | 2 | 4656.5 | both-strands | His Kinase A (phospho-acceptor) domain |
| 2 | PF01979.22 | 0.67 | 2 | 46.0 | opposite-strand | Amidohydrolase family |
++ More..