Result : EXP01669
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01669 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli K12 |
| Left | 3085920 |
| Right | 3086051 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAGAAACCGGTTGCGCAGTTGGAGCGTCAGCATTCACTGCTGGAAAATCCATGTGCTTATGGGTTGTTATCGCAGTTCCAGGCTGCGATAGTCGTTAACTGTTTTACACTTAATAAAATAATTTGA |
| Sequence | MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII |
| Source of smORF | Literature |
| Function | cytoplasm [GO:0005737] The ORF matches to the profile of cl12603. Profile Description: Virulence promoting factor. YqgB encodes adaptive factors that acts in synergy with vqfZ, enabling the bacteria to cope with the physical environment in vivo, facilitating colonisation of the host. |
| Pubmed ID | 30796087 |
| Domain | CDD:416600 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q83JS7 |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3827533 | 3827664 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3085920 | 3086051 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 704349 | 704480 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3569507 | 3569638 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 3024209 | 3024340 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 3026945 | 3027076 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 1974940 | 1975071 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 2177349 | 2177480 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 1069431 | 1069562 | - | NZ_CP053416.1 | Salmonella bongori |
| 10 | 3250918 | 3251049 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 11 | 4000154 | 4000285 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 12 | 3884012 | 3884143 | - | NC_015968.1 | Enterobacter soli |
| 13 | 1634759 | 1634890 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 14 | 805374 | 805505 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 15 | 4240853 | 4240984 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 16 | 4947770 | 4947901 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 17 | 4214290 | 4214421 | + | NZ_CP038469.1 | Citrobacter tructae |
| 18 | 3982303 | 3982434 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 19 | 3383969 | 3384100 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 20 | 3910629 | 3910760 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 21 | 3883146 | 3883277 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 22 | 3839524 | 3839655 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 23 | 1858965 | 1859096 | - | NZ_CP033744.1 | Citrobacter freundii |
| 24 | 3246470 | 3246616 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 25 | 4477058 | 4477189 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 26 | 3691483 | 3691614 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 27 | 4486455 | 4486586 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 28 | 3568482 | 3568613 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 29 | 444343 | 444474 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 30 | 3493879 | 3494025 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 31 | 4153027 | 4153173 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 32 | 841818 | 841949 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 33 | 1381940 | 1382071 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 34 | 742671 | 742817 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 35 | 51224 | 51355 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 36 | 590696 | 590842 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 37 | 807262 | 807393 | + | NZ_CP050508.1 | Raoultella terrigena |
| 38 | 2583429 | 2583560 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 39 | 840571 | 840702 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 40 | 5297583 | 5297714 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 41 | 3779679 | 3779825 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 42 | 922100 | 922246 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 43 | 782737 | 782853 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 44 | 755492 | 755623 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 45 | 4479961 | 4480092 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 46 | 776284 | 776415 | + | NZ_CP054254.1 | Klebsiella variicola |
| 47 | 760837 | 760953 | + | NZ_CP041247.1 | Raoultella electrica |
| 48 | 882352 | 882468 | - | NZ_CP026047.1 | Raoultella planticola |
| 49 | 812323 | 812439 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 50 | 596111 | 596245 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01435.20 | 0.63 | 31 | 3243.5 | opposite-strand | Peptidase family M48 |
| 2 | PF00491.23 | 0.86 | 42 | 2215 | same-strand | Arginase family |
| 3 | PF02784.18 | 1.0 | 49 | 9.0 | same-strand | Pyridoxal-dependent decarboxylase, pyridoxal binding domain |
| 4 | PF17810.3 | 1.0 | 49 | 9.0 | same-strand | Arginine decarboxylase helical bundle domain |
| 5 | PF17944.3 | 1.0 | 49 | 9.0 | same-strand | Arginine decarboxylase C-terminal helical extension |
| 6 | PF02773.18 | 1.0 | 49 | 662.0 | opposite-strand | S-adenosylmethionine synthetase, C-terminal domain |
| 7 | PF02772.18 | 1.0 | 49 | 662.0 | opposite-strand | S-adenosylmethionine synthetase, central domain |
| 8 | PF00438.22 | 1.0 | 49 | 662.0 | opposite-strand | S-adenosylmethionine synthetase, N-terminal domain |
| 9 | PF00083.26 | 1.0 | 49 | 2235.5 | opposite-strand | Sugar (and other) transporter |
| 10 | PF10263.11 | 0.67 | 33 | 3753.5 | opposite-strand | SprT-like family |
| 11 | PF17283.4 | 0.92 | 45 | 3749.0 | opposite-strand | SprT-like zinc ribbon domain |
| 12 | PF04231.15 | 0.92 | 45 | 4305.5 | opposite-strand | Endonuclease I |
| 13 | PF04452.16 | 0.67 | 33 | 5077 | opposite-strand | RNA methyltransferase |
++ More..