Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01665 |
NCBI Accession ID | BA000022.2 |
Organism | Synechocystis sp. PCC 6803 |
Left | 1431626 |
Right | 1431901 |
Strand | + |
Nucleotide Sequence | TTGACTTCTGACTCCCGTTCTGTCGCATATGCCAACTTTTTAAGAGAAAACGTTTTAGGAGAGCCACACCCCATGCGGATGTTTAGAATTACGGCTTGTGTTCCTAGCCAAACCCGGATTCGGACACAACGGGAATTACAAAATACCTATTTTACGAAGTTGGTGCCCTATGACAATTGGTTTCGTGAGCAACAGCGCATCATGAAAATGGGCGGCAAAATTGTGAAAGTCGAATTAGCCACTGGCCGTCCCGGCACCAATGCTGGTCTAGCCTAA |
Sequence | LTSDSRSVAYANFLRENVLGEPHPMRMFRITACVPSQTRIRTQRELQNTYFTKLVPYDNWFREQQRIMKMGGKIVKVELATGRPGTNAGLA |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl03191. Profile Description: CpcD/allophycocyanin linker domain. |
Pubmed ID | 30796087 |
Domain | CDD:413625 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3486176 | 3486433 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
2 | 1443376 | 1443645 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
3 | 2998474 | 2998770 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08242.14 | 0.67 | 2 | 4951.5 | opposite-strand | Methyltransferase domain |
2 | PF13649.8 | 0.67 | 2 | 4951.5 | opposite-strand | Methyltransferase domain |
3 | PF08241.14 | 0.67 | 2 | 4951.5 | opposite-strand | Methyltransferase domain |
4 | PF00427.23 | 1.0 | 3 | 1644 | same-strand | Phycobilisome Linker polypeptide |
5 | PF00502.21 | 1.0 | 3 | 350.5 | same-strand | Phycobilisome protein |
6 | PF01098.21 | 0.67 | 2 | 111.0 | same-strand | Cell cycle protein |