Result : EXP01665

Protein Information

• Protein name: EXP01665
• NCBI Accession ID: BA000022.2
• Organism: Synechocystis sp. PCC 6803
• Left: 1431626
• Right: 1431901
• Strand: +
• Nucleotide Sequence: TTGACTTCTGACTCCCGTTCTGTCGCATATGCCAACTTTTTAAGAGAAAACGTTTTAGGAGAGCCACACCCCATGCGGATGTTTAGAATTACGGCTTGTGTTCCTAGCCAAACCCGGATTCGGACACAACGGGAATTACAAAATACCTATTTTACGAAGTTGGTGCCCTATGACAATTGGTTTCGTGAGCAACAGCGCATCATGAAAATGGGCGGCAAAATTGTGAAAGTCGAATTAGCCACTGGCCGTCCCGGCACCAATGCTGGTCTAGCCTAA
• Sequence: LTSDSRSVAYANFLRENVLGEPHPMRMFRITACVPSQTRIRTQRELQNTYFTKLVPYDNWFREQQRIMKMGGKIVKVELATGRPGTNAGLA
• Source of smORF: Protein-level
• Function: The ORF matches to the profile of cl03191. Profile Description: CpcD/allophycocyanin linker domain.
• Pubmed ID: 30796087
• Domain: CDD:413625
• Functional Category: Conserved domain based functional assignment
• ORF Length (Amino Acid): 91

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3486176	3486433	+	NZ_CP021983.2	Halomicronema hongdechloris C2206
2	1443376	1443645	-	NC_019748.1	Stanieria cyanosphaera PCC 7437
3	2998474	2998770	-	NC_019675.1	Cyanobium gracile PCC 6307

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_019675.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF08242.14	0.67	2	4951.5	opposite-strand	Methyltransferase domain
2	PF13649.8	0.67	2	4951.5	opposite-strand	Methyltransferase domain
3	PF08241.14	0.67	2	4951.5	opposite-strand	Methyltransferase domain
4	PF00427.23	1.0	3	1644	same-strand	Phycobilisome Linker polypeptide
5	PF00502.21	1.0	3	350.5	same-strand	Phycobilisome protein
6	PF01098.21	0.67	2	111.0	same-strand	Cell cycle protein