Result : EXP01664
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01664 |
| NCBI Accession ID | NZ_CP009472.1 |
| Organism | Lactococcus lactis strain AI06 |
| Left | 2201076 |
| Right | 2201318 |
| Strand | - |
| Nucleotide Sequence | GTGCTGAAGAAGTTGCTGCATTACGCGGTAAATCTGTATCAGATTTCGCCTAAGGAGGAAAAAATGGCTCAAATTAAAATTACATTGGTAAACTCACCAATCGGCCGTATCCCTGCTCAACGCAAAACTGTTAAAGCACTCGGTCTTGGTAAACTCAACAGCTCAGTAGTAAAAGAAGGTTCACCTGCTATTCTTGGTATGGTAAACTCTATTTCTCACTTGGTAAAAGTTGAAGAAGCATAA |
| Sequence | VLKKLLHYAVNLYQISPKEEKMAQIKITLVNSPIGRIPAQRKTVKALGLGKLNSSVVKEGSPAILGMVNSISHLVKVEEA |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 30796087 |
| Domain | CDD:412218 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2216852 | 2217094 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 32989 | 33234 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 1757644 | 1757892 | + | NZ_CP013237.1 | Streptococcus mutans |
| 4 | 1747377 | 1747601 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 5 | 2894 | 3118 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 6 | 300059 | 300283 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 7 | 1755639 | 1755863 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 8 | 94441 | 94665 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 9 | 2029754 | 2029978 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 10 | 485928 | 486152 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 11 | 1479882 | 1480130 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 12 | 2012276 | 2012473 | - | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 13 | 5695114 | 5695356 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 14 | 2148594 | 2148794 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 15 | 1084251 | 1084448 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 16 | 3615911 | 3616153 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 17 | 1491833 | 1492045 | - | NZ_CP011390.1 | Flavisolibacter tropicus |
| 18 | 1848705 | 1848938 | - | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 19 | 699221 | 699424 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134336.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01176.21 | 0.79 | 15 | 2809 | same-strand | Translation initiation factor 1A / IF-1 |
| 2 | PF00406.24 | 0.79 | 15 | 2054 | same-strand | Adenylate kinase |
| 3 | PF13207.8 | 0.79 | 15 | 2054 | same-strand | AAA domain |
| 4 | PF13671.8 | 0.74 | 14 | 2056.0 | same-strand | AAA domain |
| 5 | PF00344.22 | 1.0 | 19 | 598 | same-strand | SecY |
| 6 | PF00828.21 | 1.0 | 19 | 145 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 7 | PF00333.22 | 1.0 | 19 | -28 | same-strand | Ribosomal protein S5, N-terminal domain |
| 8 | PF03719.17 | 1.0 | 19 | -28 | same-strand | Ribosomal protein S5, C-terminal domain |
| 9 | PF00861.24 | 1.0 | 19 | 485 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 10 | PF00347.25 | 1.0 | 19 | 924 | same-strand | Ribosomal protein L6 |
| 11 | PF00410.21 | 1.0 | 19 | 1653 | same-strand | Ribosomal protein S8 |
| 12 | PF00253.23 | 0.74 | 14 | 2277.0 | same-strand | Ribosomal protein S14p/S29e |
| 13 | PF00444.20 | 0.68 | 13 | 3049 | same-strand | Ribosomal protein L36 |
++ More..